SecReT6
Effector Protein ID: 227117880
hcp-1
SecReT6 ID487
T6SS typeN/A
Gene symbolhcp-1
Locus tagVC395_1534
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012582] [Browse all T6SS(s) in this replicon]
Location [Strand]1599520..1600038 [+]
Producthcp protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDA5F8B9
KEGG IDvco:VC0395_A1025, vcr:VC395_1534
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-37, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|227117880|ref|YP_002819776.1| hcp protein [Vibrio cholerae O395]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKSVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|227116370|ref|NC_012582.1|:1599520-1600038 Vibrio cholerae O395 chromosome chromosome I, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGTGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
TGTGACTGTACCGACTGACCCACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCTGGTGAGAAGCTGAAGTCGG
TTGAGCTGAAGTGGTACCGTACCTCTATCGAAGGTAAACAAGAGAACTTCTTCACCACTAAGCTGGAAAA
CGCGTCTATCGTCGACATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA