SecReT6
Effector Protein ID: 227119202
hcp-2
SecReT6 ID487
T6SS typeN/A
Gene symbolhcp-2
Locus tagVC395_A0014
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]19781..20299 [+]
Producthcp protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDA5F1M6
KEGG IDvcr:VC395_A0014, vco:VC0395_0116
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.20E-37, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|227119202|ref|YP_002821097.1| hcp protein [Vibrio cholerae O395]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKSVELKWYRTSIEGKQENFFTTKLENASIIDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|227119188|ref|NC_012583.1|:19781-20299 Vibrio cholerae O395 chromosome chromosome II, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGCGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
CGTAACCGTACCGACTGACCCACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCAGGTGAGAAGCTGAAGTCGG
TTGAGCTGAAGTGGTACCGTACTTCTATCGAAGGTAAACAAGAAAACTTCTTTACCACTAAGCTGGAAAA
CGCGTCTATCATCGATATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA