SecReT6
Effector Protein ID: 227119203
vgrG-2
SecReT6 ID487
T6SS typeN/A
Gene symbolvgrG-2
Locus tagVC395_A0015
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]20427..22511 [+]
ProductvgrG protein
Effector typeProtein
Homologous effectorVCA0018
Descriptiontype VI secretion system Vgr family protein
UniProt IDA5F1M5
KEGG IDvcr:VC395_A0015, vco:VC0395_0115
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-65, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 208..227
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 374..467
Phage_Mu_Gp45 [PF06890], Evalue: 0.00088, Aligned region: 426..452
Phage_Mu_Gp45 [PF06890], Evalue: 0.00088, Aligned region: 569..618
DUF2345 [PF10106], Evalue: 0.0018, Aligned region: 575..617
Protein Sequence: 694 a.a.     [Download]
>gi|227119203|ref|YP_002821098.1| vgrG protein [Vibrio cholerae O395]
MATLAYSIEVEGLEDETLVVRGFHGQEPLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKIY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYELTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYA
FALKRDCVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGG
TMDTPYIHGLTYRTQAEVSEVQLKDYSFKKPTYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEEGGSGATTYN
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSE
IGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGS
GSGYGGKMAELPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN
-
Nucleotide Sequence: 2085 bp     [Download]
>gi|227119188|ref|NC_012583.1|:20427-22511 Vibrio cholerae O395 chromosome chromosome II, complete sequence
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTTC
ACGGGCAGGAGCCACTCTCCAACAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTACGAAGTGCA
ACTGGCGAGTCGGGTATCCAATCTGACTGCTGAGCAGATGGTGGATAAGCGTGCTGAGCTCAAGATTTAC
CGCAATTCACAGTTGGTGCAGCGCGTGCACGGCATTGTACGTGCTTTCAGCCAAGGCGATATCGGCCATC
ATCACACCTTCTACGAACTCACTTTAGTGCCTGCCTTAGAGCGCTTATCCCTGCGCCACAATAGCCGCAT
TTTCCAAAAGCAGACTGTTCCAGAAATTCTCTCTATCTTGCTGCAAGAGATGGGCATCCACGATTACGCT
TTTGCGCTCAAACGTGATTGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGTGAAAGTGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGCTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCTAGTGACAGCCTAAGTAAACTGCCGGAGCCCATCCCGTACAACGCCTTAGCGGGCGGC
ACGATGGATACACCGTACATCCACGGCTTAACCTATCGCACCCAAGCGGAAGTGAGCGAAGTTCAGCTCA
AAGATTACAGCTTCAAAAAGCCGACGTACTCGTTTTTACAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCACACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCATCTTGACCCTGCGATGAACCGCGATTGGGTGGTGGTCTC
TATTAACCATCAAGGTGAGCAGCCGCAAGCGTTACAAGAAGAGGGCGGCAGTGGTGCAACGACCTACAAC
AACCAGTTCAGCTTAATTCCAGGGCATCTCCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATAGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACACGGGCGGGTGAA
AATCCATTTTCCGTGGGACCGCTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGTCATGAAGTGATTGTTTCTTTCT
TAAATGGCGACCCAGACCAACCGATTATCACTGGCCGCACCTATCATGCGACCAATACGCCGCCATACAC
TTTGCCAGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAAGGGTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGACTTCGATGGTTTGATTG
AAAACGACCACACCACGGTCATTCGCCACGACCAACACCTGACCGTTGAAAACGACCAGTTCACTCAGAT
TAAGCACAACCAACACCTGACGGTCGAGGGGGAGAGTCGTACGCTCGTCAAACTCGACTGCAGCAGCGAA
ATCGGCGGTTCATTGCAGCAAAAAATCGGCAGCAAAGCGATTTACGATGCAGGCACAGAGGTTCACCTTA
AAGCGGGTAACAAACTGGTCTTGGAAGCAGGCAACGAGCTTACCATCAAAGCCGGCGGCAGTTTTATTAA
AGTCGATGCTGGCGGTGTGCACGTCGTCGGCTCTGCTATTAACCTCAACTCCGGCGGCAGCGCAGGCAGC
GGCTCAGGCTATGGCGGTAAAATGGCCGAGTTGCCACAAGGGGTGGATAAAGCCAAAACGCCGCAAGAGA
TTGAGCTAGCCGCGGTAACTCCCACTCAGCAGTCTATGTCGCCTTTACTTAAGGCGCGACAAATTGAAGC
ACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAAATTAA