SecReT6
Effector Protein ID: 227119503
-
SecReT6 ID487
T6SS typeN/A
Gene symbol-
Locus tagVC395_A0322
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]340069..340740 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0285
DescriptionTseH
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 223 a.a.     [Download]
>gi|227119503|ref|YP_002821398.1| hypothetical protein VC395_A0322 [Vibrio cholerae O395]
MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILI
NGETGVTRYYEYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRG
KFFSEADSWLRGKMDLNNSPDKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDL
DYDYKTNKLTVSE
-
Nucleotide Sequence: 672 bp     [Download]
>gi|227119188|ref|NC_012583.1|:340069-340740 Vibrio cholerae O395 chromosome chromosome II, complete sequence
ATGACTGACACTGTATCATCAACTCCAGTAGCCGATACAACTCCATATGAGATATTTCTTTCAGGTAATG
ACGATTTTTTGATACCTGTAGTATTTCCTGACTACCTAATCTCAGTCGCAGATGAACAATCTTTTGAGTT
ATGGGGTGTAAAAATAAAAACTCCTGCAGTGAAGGCCCCCTACCTTGGTCACGCTGGAGTTATTTTGATT
AATGGTGAAACAGGTGTTACTCGCTATTATGAGTATGGCCGTTACAAGAACCCTAAATCGGATATCCCAG
GAAATGTGAGGAAGGTTGGGGTATCAAATGTAACTATAAAAAGTGGTCTAATTACTGAAAGCTCGTTACT
GAAGGTTCTTAAAGAAGTGTCCCTACGTTCTGGACAGGAGGGGAGAATTTCGGGAGTGGTATTAAGAGGA
AAGTTTTTCTCTGAAGCAGATTCATGGTTAAGGGGAAAAATGGATCTTAATAATAGCCCTGATAAGATAC
CTTATGACTTGGATAGCCATAACTGCATGACATTTGTCATAGATTTAGCTGATGCAATGGGGTTAGACCC
GGCTTGGAAACCTCCTGTTGTTGTACCAAGCGCGTATATTGAACAGTTTCAGTTAAGTGAAATTGATTTA
GATTATGACTATAAGACCAACAAATTAACGGTATCTGAGTGA