SecReT6
Effector Protein ID: 227811908
-
SecReT6 ID335
T6SS typeA1
Gene symbol-
Locus tagVCM66_A0284
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]306399..307070 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0285
DescriptionTseH
UniProt IDC3LUV6
KEGG IDvcm:VCM66_A0284
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 223 a.a.     [Download]
>gi|227811908|ref|YP_002811918.1| hypothetical protein VCM66_A0284 [Vibrio cholerae M66-2]
MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILI
NGETGVTRYYEYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRG
KFFSEADSWLRGKMDLNNSPDKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDL
DYDYKTNKLTVSE
-
Nucleotide Sequence: 672 bp     [Download]
>gi|227811634|ref|NC_012580.1|:306399-307070 Vibrio cholerae M66-2 chromosome II, complete genome
ATGACTGACACTGTATCATCAACTCCAGTAGCCGATACAACTCCATATGAGATATTTCTTTCAGGTAATG
ACGATTTTTTGATACCTGTAGTATTTCCTGACTACCTAATCTCAGTCGCAGATGAACAATCTTTTGAGTT
ATGGGGTGTAAAAATAAAAACTCCTGCAGTGAAGGCCCCCTACCTTGGTCACGCTGGAGTTATTTTGATT
AATGGTGAAACAGGTGTTACTCGCTATTATGAGTATGGCCGTTACAAGAACCCTAAATCGGATATCCCAG
GAAATGTGAGGAAGGTTGGGGTATCAAATGTAACTATAAAAAGTGGTCTAATTACTGAAAGCTCGTTACT
GAAGGTTCTTAAAGAAGTGTCCCTACGTTCTGGACAGGAGGGGAGAATTTCGGGAGTGGTATTAAGAGGA
AAGTTTTTCTCTGAAGCAGATTCATGGTTAAGGGGAAAAATGGATCTTAATAATAGCCCTGATAAGATAC
CTTATGACTTGGATAGCCATAACTGCATGACATTTGTCATAGATTTAGCTGATGCAATGGGGTTAGACCC
GGCTTGGAAACCTCCTGTTGTTGTACCAAGCGCGTATATTGAACAGTTTCAGTTAAGTGAAATTGATTTA
GATTATGACTATAAGACCAACAAATTAACGGTATCTGAGTGA