SecReT6
Effector Protein ID: 229590993
-
SecReT6 ID786
T6SS typeA1
Gene symbol-
Locus tagPFLU3550
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3937598..3938113 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDC3K7V0
KEGG IDpfs:PFLU3550
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-38, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|229590993|ref|YP_002873112.1| hypothetical protein PFLU3550 [Pseudomonas fluorescens SBW25]
MPTPAYLSITGVKQGLITAGTFTQDSVGNIYQEGHEDQILVQAFAHQVIIPRDPQSGQPTGQRVHKPLMI
SKVFDKSSPLLFSALTSGEEVKCRLEWLRTSSAGTQEHYFTIELEGATIVDIQSRMPNCQDPDNAHFTHL
EDVYFTYRKIVWTHEVSGTSGSDDWRSPVAG
-
Nucleotide Sequence: 516 bp     [Download]
>ref|NC_012660.1|:3937598-3938113 hypothetical protein PFLU3550 [Pseudomonas fluorescens SBW25]
ATGCCAACACCCGCGTATCTTTCCATCACCGGTGTCAAACAAGGTTTGATTACGGCAGGCACGTTTACCC
AGGACTCGGTAGGTAATATTTACCAAGAAGGCCATGAGGATCAGATTCTGGTCCAGGCTTTTGCTCATCA
AGTGATCATCCCGCGCGACCCACAATCCGGCCAGCCAACAGGCCAAAGGGTCCATAAACCGTTGATGATC
AGCAAAGTGTTCGATAAGTCCTCGCCCTTGCTGTTCAGCGCGTTGACCAGCGGCGAAGAGGTCAAGTGCC
GGCTCGAATGGTTACGCACCTCGTCGGCCGGCACCCAAGAGCACTACTTCACGATTGAACTGGAGGGGGC
AACCATCGTCGACATCCAGTCGCGCATGCCCAACTGCCAGGATCCGGACAACGCCCATTTCACCCACTTG
GAAGATGTGTACTTCACCTATCGCAAGATCGTATGGACCCACGAAGTGTCCGGCACTTCCGGGTCGGATG
ACTGGCGCAGCCCGGTAGCGGGCTAA