SecReT6
Effector Protein ID: 229605273
-
SecReT6 ID336
T6SS typeA1
Gene symbol-
Locus tagVCD_000213
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]246869..250126 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0020
DescriptionVasX protein
UniProt IDC3NYI9
KEGG IDvcj:VCD_000213
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1085 a.a.     [Download]
>gi|229605273|ref|YP_002875977.1| hypothetical protein VCD_000213 [Vibrio cholerae MJ-1236]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWKGQFSIKQRSY
TLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSKGESKSCLLYPAQHTLSIGYA
HQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHAHFAQYLEDYVADIGTPAEQDIFKDTCTPSL
PVEKSEEAVKGTEFKFVADKAVVSSSDYLQDLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGD
ETQQHKMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESHHLASEGHSPSG
NYALMQQQAEQKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHY
AQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSFDSPKNLMALA
STGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDERIQEKAWFKRWIEPAQSSFGA
LQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAELKQFETKL
NAILQEMNDALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALS
KNVKTSSASVSQKLGGLGGLLFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGA
ISAGRAWVTIAEQGLLDRTLKNALNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILTNVFKR
SELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLKG
QTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLRWGKE
LSLKFYASGTRAGELDLQSAEANDIATRNLVVGKG
-
Nucleotide Sequence: 3258 bp     [Download]
>ref|NC_012667.1|:c250126-246869 hypothetical protein VCD_000213 [Vibrio cholerae MJ-1236]
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGACAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTC
CTTTTAAACAGCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATGATCAAGGTCA
AGCATTACATCCTTTACCCAAAGCGGATCGACAGTGGAAAGGTCAATTCTCTATCAAGCAGCGCAGTTAC
ACTTTAAGGCAACTGCGTGATGGCTGGCTCTATGTCTATGATGAAACAGCAAAAACACTGCACGAATATG
AAGTCGTTGGCTGCAAGTTGACCAAAATTGATTGGTCTGATGATGAGGCAAACAAACCCACTCACGAGCG
CGGTTCGAAAGGTGAAAGCAAAAGCTGTTTACTCTATCCCGCCCAGCACACGCTCTCTATCGGTTATGCG
CATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGCCGTCATGCTGTGATGC
GTAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCCTCATGCACATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCAGCTGAGCAGGATATTTTTAAAGATACCTGTACCCCTTCATTA
CCGGTAGAGAAAAGTGAAGAAGCGGTGAAAGGTACGGAATTCAAATTCGTTGCCGACAAAGCGGTGGTAA
GCAGCAGTGATTATTTGCAAGATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTT
AGCGGATGTGTCAGATTTATTTGTTACTTTTACTACCCAAGTGGCAAAGCGAACTAAAGCGATTGGTGAT
GAAACGCAACAGCATAAAATGCAGATGGCAGAGCTGACACGCACATTAGGCCGAATTCGTCTTGAAGAAA
AAGAAATTCCCGATTTTGTAAAACAAGATCCGATCCGTATTTTAGAGCTAGAAAGAGCCATTACTGAATA
TTGTGCTACGGCAAAATTGGCCGAAATCGAATCTCATCATTTAGCCAGTGAAGGGCATTCCCCATCGGGA
AACTATGCCTTGATGCAGCAGCAAGCGGAGCAGAAACTGGCGGAATTGAAAACACTCTATCGCTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACAGCTTTATTGATGAAGTGCGTTGGGCGGA
TTTAGATAACTTTTTGGTGGAGCATTACACCGAGCTCAAAGGATTGGATGAACAGATTAAACAACACTAT
GCGCAGTTTATGTCTGCCTTCAACCAGCTCGGCCTTGACCCGCTTCTGTTTGGTATGGATAACCAAGATG
AGGTTCAGCAAGCGTATTTGTTAGCATTAACTAGCCAATTTTTAGTGGTGGTTACGCAAGTCAATCATGA
TGAAAAATCGCTTGAGATCCTAAAAAAAGATCTCAGTTTTGATTCACCGAAAAACCTCATGGCCCTCGCG
TCAACAGGCTTTTCCCTGCAGGCAAATCAAGCCATTAACAACCATATCCAAGGGTTTAGCACCGCTTTTC
TCTCTACAAGTAATCCTAGTGATATGGTGGCGTTTGCGACCGCAATCGCTAACTGGGATACGTTCACGGG
GGATGAACGTATTCAGGAGAAAGCATGGTTTAAGAGATGGATTGAACCCGCTCAATCGAGTTTTGGTGCA
CTGCAAAAAGCGGTCGCCAATCAAGCCAAAGAGAGTTGGCAAGCGGTGATGGAGTTGCTGTTTCCTTATC
AGAATCAGCCCAAAGGAGGGACGCCCAGTTTGTTGGCTAACCTTCGTTTACTGTTGGTGGAAAGCCTAGT
TCGAGAAGAGGCGGTGCTGCAACATAACCCCAAGTATGCGGCTGAGCTTAAGCAATTTGAGACTAAGCTG
AATGCCATTTTGCAAGAGATGAATGATGCTCTGGAACTCAAACCCGGTAATGTGAGCCCGAAAAACCATC
AAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCAATTACTCAGTAGTGAGCTGCCGATGATGCT
GACGCTCAAAAACCAAGCTGCGATGAACACTTTTCAGCAGTCGGTAAATGAGAAACTGAGCGCGCTATCG
AAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAGAAACTGGGTGGATTAGGGGGCTTGCTGTTTGCGT
TGAACCTATGGAATACCATGACGGTTTTGGAGAATATCCGCTATAAGGTCGCACAATACCCCAGTTGGAA
TCCTTTTAAGAACCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCAACACTATTGTAGTCGCCGGTGCC
ATTAGTGCTGGGCGAGCTTGGGTGACGATTGCTGAGCAAGGGTTGTTAGATCGTACACTGAAAAACGCCT
TAAATACCACGAAAGTTTTGGGCACAAAAGATGCCCTAAAAACCTTTGCTAAATCGATCGCCTTGGTGGC
TACCGTGGGCATGATTGCCAGCGCATTAGAAACATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAA
ACCGATCTTGAACGCTTCGGTTATTTGTTAAAAGCTGGAGCAACGGGAGCACAGGGAATTATTTTTTATA
TTCAGTTTTTCACACTCTTAGGTAGTGGAATTGGTGGACCCTCCATAGCTGCGATTTCTGCAGGTTGGAT
GCTCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGTGTTTAAACGC
TCAGAGTTAGAAATTTGGTTATCAAAATCGACGTGGGGGAAAGAGAGTGCTCATTGGCCAGTGGGCAAAG
AATTGACCGAGTTAGAGCACCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAAAGC
AGCGCAATGGATGGATTCAGGTTCTTTACAATGGCAGTTGGAACTCACGTTACCCGATTATCTTAAGGGG
CAGACGATAGGCTTACAAATCACCCGTTTGCCAGCGCAGCCGGCATATTATCAACCGCAAAGGGAGGCGG
TAACACCAATACTCATCAATGAACAACAGGGCAAATGGAGTATTGAAGATAATCAGCCAGTGTATCGTAT
TACACTGGGTGGCAGTGAGAAGGATACTGTCGGAGTTTGCGTTGCACTGCCCCTGCGTTGGGGCAAGGAG
CTGAGCCTCAAATTCTATGCCAGTGGAACTCGCGCGGGGGAATTGGATTTACAATCTGCAGAGGCGAATG
ATATTGCCACAAGAAATCTCGTTGTAGGAAAAGGTTAA