SecReT6
Effector Protein ID: 229605275
-
SecReT6 ID336
T6SS typeA1
Gene symbol-
Locus tagVCD_000215
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]251010..253094 [-]
ProductVgrG protein
Effector typeProtein
Homologous effectorVCA0018
Descriptiontype VI secretion system Vgr family protein
UniProt IDC3NYJ1
KEGG IDvcj:VCD_000215
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-64, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 208..227
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 374..467
Phage_Mu_Gp45 [PF06890], Evalue: 0.00087, Aligned region: 426..452
Phage_Mu_Gp45 [PF06890], Evalue: 0.00087, Aligned region: 569..618
DUF2345 [PF10106], Evalue: 0.0018, Aligned region: 575..617
Protein Sequence: 694 a.a.     [Download]
>gi|229605275|ref|YP_002875979.1| VgrG protein [Vibrio cholerae MJ-1236]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYQMQLASRVSNLTADQMVDKRAELKLY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYA
FALKRDCVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGG
TMDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEEGGSGATTYN
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSE
IGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGS
GSGYGGKMAELPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN
-
Nucleotide Sequence: 2085 bp     [Download]
>ref|NC_012667.1|:c253094-251010 VgrG protein [Vibrio cholerae MJ-1236]
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTTC
ACGGGCAGGAGTCACTCTCCAACAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTATCAAATGCA
ACTGGCGAGTCGGGTATCCAATCTGACTGCCGACCAGATGGTCGATAAGCGTGCTGAGCTCAAGCTTTAC
CGCAACTCACAATTGGTGCAGCGTGTGCACGGCATTGTACGTGCCTTTAGCCAAGGCGATATCGGCCATC
ACCACACCTTCTACCAACTCACTTTAGTGCCTGCCTTAGAGCGCTTATCCCTGCGCCACAATAGCCGCAT
TTTCCAAAAGCAGACTGTTCCAGAAATTCTCTCTATCTTGCTGCAAGAGATGGGCATCCACGATTACGCT
TTTGCGCTCAAACGTGATTGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGTGAAAGTGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGCTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGACAGCCTAAGTAAACTGCCGGAGCCCATCCCGTACAACGCCTTAGCGGGCGGC
ACGATGGATACACCGTACATCCACGGCTTAACCTATCGCACCCAAGCGGAAGTGAGCGAAGTTCAGCTCA
AAGATTACAGCTTCAAAAAGCCGGCGTACTCGTTTTTACAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCACACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCATCTTGACCCTGCGATGAACCGCGATTGGGTGGTGGTCTC
TATTAACCATCAAGGTGAGCAGCCGCAAGCGTTACAAGAAGAGGGCGGCAGTGGTGCAACGACCTACAAC
AACCAGTTCAGCTTAATTCCAGGGCATCTCCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATAGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACACGGGCGGGTGAA
AATCCATTTTCCGTGGGACCGCTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGTCATGAAGTGATTGTTTCTTTCT
TAAATGGCGACCCAGACCAACCGATTATCACTGGCCGCACCTATCATGCGACCAATACGCCGCCATACAC
TTTGCCAGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAAGGGTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGACTTCGATGGTTTGATTG
AAAACGACCACACCACGGTCATTCGCCACGACCAACACCTGACCGTTGAAAACGACCAGTTCACTCAGAT
TAAGCACAACCAACACCTGACGGTCGAGGGGGAGAGTCGTACGCTCGTCAAACTCGACTGCAGCAGCGAA
ATCGGCGGTTCATTGCAGCAAAAAATCGGCAGCAAAGCGATTTACGATGCAGGCACAGAGGTTCACCTTA
AAGCGGGTAACAAACTGGTCTTGGAAGCAGGCAACGAGCTTACCATCAAAGCCGGCGGCAGTTTTATTAA
AGTCGATGCTGGCGGTGTGCACGTCGTCGGCTCTGCTATTAACCTCAACTCCGGCGGCAGCGCAGGCAGC
GGCTCAGGCTATGGCGGTAAAATGGCCGAGTTGCCACAAGGGGTGGATAAAGCCAAAACGCCGCAAGAGA
TTGAGCTAGCCGCGGTAACTCCCACTCAGCAGTCTATGTCGCCTTTACTTAAGGCGCGACAAATTGAAGC
ACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAAATTAA