SecReT6
Effector Protein ID: 229605276
-
SecReT6 ID336
T6SS typeA1
Gene symbol-
Locus tagVCD_000216
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]253222..253740 [-]
ProductHcp protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDC3NQN3
KEGG IDvcj:VCD_000216, vcj:VCD_002932
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.30E-38, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|229605276|ref|YP_002875980.1| Hcp protein [Vibrio cholerae MJ-1236]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>ref|NC_012667.1|:c253740-253222 Hcp protein [Vibrio cholerae MJ-1236]
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGCGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCATGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
CGTAACCGTACCGACTGACCCACAATCTGGTCAGCCTTCCGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCAGGTGAGAAGCTGAAAACCG
TTGAGCTGAAATGGTACCGTACTTCTATCGAAGGCAAACAAGAAAACTTCTTCACCACTAAGCTGGAAAA
CGCGTCTATCGTTGATATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA