SecReT6
Effector Protein ID: 229608011
-
SecReT6 ID336
T6SS typeA1
Gene symbol-
Locus tagVCD_002929
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012668] [Browse all T6SS(s) in this replicon]
Location [Strand]2127535..2129460 [-]
Productlipase family protein
Effector typeProtein
Homologous effectorVC1418
DescriptionTseL
UniProt IDC3NQN0
KEGG IDvcj:VCD_002929
PDB IDNA
Domain hit(s) vs Pfam Lipase_3 [PF01764], Evalue: 1.20E-22, Aligned region: 319..434
CarboxypepD_reg [PF13620], Evalue: 0.0047, Aligned region: 23..88
Protein Sequence: 641 a.a.     [Download]
>gi|229608011|ref|YP_002878659.1| lipase family protein [Vibrio cholerae MJ-1236]
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKIAAGEWRASVS
QASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWDEAPKDEFLQKQHKGIDVNAS
AEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSYTFALLSKLAYATNDFNRDDGKTIDNQGAIS
TVISQLKRKERPTYSGDLQAKWLLEEIPYSKALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSK
KPPVDNTKFKIIKAASGMAAVIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALL
SLMEKDLGLHKIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRH
VNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTYNSNNQVLLTP
KQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALSDESLMVHYQRAISALEQEIA
TLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLIENRNKIRGELRQIVSDPQRMPATKFLISQQ
TLPDEIKVQIR
-
Nucleotide Sequence: 1926 bp     [Download]
>ref|NC_012668.1|:c2129460-2127535 lipase family protein [Vibrio cholerae MJ-1236]
ATGGATTCATTTAATTATTGCGTGCAGTGTAACCCTGAGGAAAACTGGTTAGAGCTAGAGTTTCGGAGTG
AAAATGATGAACCGATAGATGGTTTGCTAGTTACGATTACGAACCAAAGTGCCCCCTCTAACACATACAC
GCAAACCACAAGTTCGGGTAAGGTGTTGTTTGGCAAGATTGCGGCTGGGGAATGGCGTGCTTCTGTAAGC
CAAGCTTCTCTGTTAACTGAAGTCGAAAAATATGCCAGCCGTAAAGAGGGACAAGAGTCGCCAGTGAAAA
AACGAGCTGCGGCAGAACTTGACGCCGCAGATAAAGATACGAAGCAGTACCGCTTTACCACTATTGGTGA
TTTCTGGGATGAAGCACCAAAAGATGAGTTTTTACAAAAGCAGCATAAAGGGATAGATGTCAATGCTTCT
GCTGAGAAAGCAGGGTTTAGACTCAGTCATAACCAGACCTATGTTTTTGAAATCAAAGCACTACGTAGCT
ATATGCCAGTGATTATTGATACCGATGAATTTAACTTGGTGAATAGTTATACCTTTGCGTTGTTGTCGAA
ATTAGCTTATGCGACTAACGATTTTAATAGGGATGATGGTAAGACAATAGATAATCAGGGAGCAATTAGC
ACGGTTATTTCTCAATTGAAGCGTAAAGAAAGACCGACTTATTCTGGAGATTTACAAGCAAAGTGGTTAT
TAGAGGAAATTCCATATAGCAAAGCGTTAAGTGCCCAATATTATGCTGAGGATGATGTCGGTAGTGAAGG
TTACATCATCTTTAACGATGAATTGGCGATTATAGGTGTGAGAGGTACAGAGCCTTATTTTCAGAGTAAG
AAACCACCTGTTGATAACACTAAATTTAAAATTATAAAAGCGGCTTCAGGTATGGCGGCTGTGATTGCGG
ATAAGATAGAAAGTGCTACCGATTCACCAGGAATGAAAGACCTTATTATAACAGACCTTGATGCTGCGCA
AATCGCCCCCGAAGAGTTTGGTGGAACATATGTTCATCGGGGGTTTTACCAATATACGATGGCTTTGTTA
TCTTTGATGGAGAAAGATCTAGGGCTACATAAAATAAAAAAATTCTATTGTTGTGGCCATAGCTTAGGGG
GCGCTGGTGCATTACTTATAAGTGCATTGATTAAAGATAGCTATCATCCTCCAGTATTGCGTTTATATAC
ATATGGAATGCCACGAGTGGGAACTCGCAGTTTTGTAGAGCGCTATCAAAATATTTTGCATTACCGTCAT
GTTAATAATCACGATTTGGTGCCACAGATACCAACAGTATGGATGAACACAGATGTATCTGAAGGATTCC
ATGTACTTGATGTATTTAAAAGCCGTGTTGATCTGATGAGAAAAATGCTCACTGATGATGATGATGACAA
TTATCAACACCATGGTCATTTGTCTCAGTTACTAACTTATAATTCAAATAACCAAGTCTTACTGACACCC
AAACAAACTCAAGTCACTATGCTAGACCTAGCAAATTTAGCCACTAATGATTCTGTTGCTATGGTAGATG
GTTTATCAGATGCCTCAATAGTAGAGCATGGAATGGAGCAGTATATACCCAATTTATTTGAGCAGTTAAC
AGCACTAAGTGATGAAAGTTTAATGGTGCATTATCAACGAGCGATTTCAGCCTTAGAGCAGGAAATTGCT
ACGTTGCAACAAAGTTATCTTACAGTTAAACAAGCTTGGATTGAATCTATAGGAAATGGCACGCCGACTA
TGAATATCGGACGTTTGATGAGTGAAATGCATTCTATAAATAAATTAATAGAGAACCGTAATAAAATTAG
AGGTGAGCTAAGGCAGATAGTCTCTGATCCTCAGCGTATGCCTGCAACTAAATTTTTAATTTCACAGCAA
ACCTTACCAGATGAAATCAAGGTGCAAATAAGATGA