SecReT6
Effector Protein ID: 229608013
-
SecReT6 ID336
T6SS typeA1
Gene symbol-
Locus tagVCD_002931
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012668] [Browse all T6SS(s) in this replicon]
Location [Strand]2130302..2133793 [-]
ProductVgrG protein
Effector typeProtein
Homologous effectorVC1416
Descriptiontype VI secretion system Vgr family protein
UniProt IDC3NQN2
KEGG IDvcj:VCD_002931
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-64, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 6.90E-24, Aligned region: 208..226
Phage_base_V [PF04717], Evalue: 6.90E-24, Aligned region: 374..467
Protein Sequence: 1163 a.a.     [Download]
>gi|229608013|ref|YP_002878661.1| VgrG protein [Vibrio cholerae MJ-1236]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKLY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGINDYA
FALKRDGVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALVGG
AIDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEDGGSGATTYS
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDHHLTVENDQFTQIKHNQHLTVEWESREAVTGEQVLS
IEGSLHVKTGKVWVNEAGTEIHVKAGQKVVIEAGSEITVKAGGSFVKVDPAGVHLSGALVNLNSGGSAGS
GSGFGGAMPALPGGLEPAVALAPPQTISYQALLQAEQANVPAVKVCPLAAQEATPAVNSITPPPPPPIAP
PMAPPQPIMNPQPTANAQPNLGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGD
ALFMLTKDMNQGSYQRPPSLQDGKNYQNWQTHTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQS
NHQPLAPIQSEDGRFVIEITNAKHVIAAGNGISAESQGQTITMTPSGQQATVGVAAKGFGTSATPELRLL
ESAPWYQKSLKSQFASLTSAENLDDKELAANVFAYLTSIYLKTAELAKKFGIYINEWDPMSEQITPNANG
LTDPKVKNAWEILPRTKPSKIVEILSKSDAKAVMKHIKPQLQSRYSESLSKNVFQYFQDGGEVAGHGINN
ATVGDKHSPELAILFEFRTVPNELQSYLPKTESTTKSEVKLLDQFDPMKRKTVIQQVESLVQNSGDAFDK
WYQSYRDSMNQPPVKNAKKIASANQKAQWVKEHNPQEWQRIIA
-
Nucleotide Sequence: 3492 bp     [Download]
>ref|NC_012668.1|:c2133793-2130302 VgrG protein [Vibrio cholerae MJ-1236]
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTCC
ACGGGCAGGAGTCACTCTCTAATAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTACGAAGTGCA
ACTGGCGAGTCGGGTATCAAACCTCACCGCCGAGCAGATGGTGGATAAGCGTGCCGAGCTCAAGCTTTAC
CGCAACTCACAGTTGGTGCAGCGCGTGCACGGCATTGTGCGTGCTTTCAGCCAAGGCGATATCGGCCATC
ACCACACCTTCTACCAACTCACTTTAGTCCCTGCCTTAGAGCGCTTATCCCTGCGTCATAACAGCCGCAT
TTTCCAAAAGCAGACTGTCCCTGAGATTCTCTCTATCTTGCTGCAAGAGATGGGCATCAACGATTACGCT
TTTGCGCTCAAACGTGATGGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGCGAAAGCGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGTTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGATAGCCTAAGCAAACTGCCGGAGCCTATCCCATACAACGCTTTAGTCGGTGGC
GCGATAGATACCCCGTATATCCACGGCTTAACCTATCGCACCCAAGCAGAAGTGAGCGAAGTTCAGCTCA
AAGACTACAGCTTCAAAAAGCCAGCCTACTCCTTTTTGCAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCATACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCACCTTGACCCCGCGATGAACCGCGATTGGGTGGTAGTGTC
GATTAACCACCAAGGTGAGCAGCCGCAAGCGCTACAAGAAGACGGTGGCAGCGGCGCTACTACTTACAGC
AATCAGTTCAGCTTAATTCCGGGGCATCTTCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATTGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACATGGGCGGGTGAA
AATCCATTTCCCGTGGGACCGTTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGCCATGAAGTGATTGTAGAGTTTT
TAAACGGTGACCCAGACCAACCGATTATCACTGGCCGCACTTATCATGCGACCAACACGCCGCCATACAC
CTTGCCTGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAGGGCTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGATTTTGATGGTTTGATTG
AAAACGACCACACCACGGTCATTCGTCACGACCATCACCTGACCGTTGAAAACGACCAATTTACCCAGAT
TAAGCACAACCAACACCTGACGGTGGAGTGGGAAAGTCGAGAAGCGGTAACGGGCGAGCAAGTGCTGAGT
ATTGAAGGCTCGCTGCATGTGAAAACAGGCAAAGTTTGGGTCAATGAAGCGGGTACAGAGATCCATGTAA
AAGCGGGACAGAAAGTGGTGATTGAAGCGGGCTCCGAGATTACCGTTAAAGCGGGCGGCAGCTTTGTGAA
AGTCGATCCGGCTGGGGTGCATCTGTCCGGTGCTTTGGTCAATCTCAACTCTGGCGGCAGCGCTGGTAGT
GGTAGCGGCTTTGGCGGTGCAATGCCCGCCTTACCGGGCGGCTTAGAACCCGCCGTGGCACTGGCTCCAC
CGCAAACCATCTCTTACCAAGCGTTGCTACAGGCCGAGCAAGCGAATGTTCCTGCGGTGAAGGTGTGTCC
TTTAGCCGCTCAAGAAGCAACGCCTGCGGTGAATAGTATCACGCCGCCTCCACCACCACCGATTGCTCCG
CCAATGGCCCCACCACAACCAATAATGAATCCACAGCCAACCGCTAACGCGCAGCCTAATCTTGGAAGAT
CCACTAAGGCAACGCCGGATTTTCCAACACATTTCCCGAAGTCATCCATTGGCATTGAGAATGAGTTAGC
TGGTCTAGTGGTGGCTATGCCAGCCAACTCGGCACAGAAATTTGGCTACGTGAAAAGTGCACAAGGTGAT
GCGCTGTTTATGTTAACGAAAGACATGAACCAAGGTTCGTATCAGCGGCCACCTTCATTACAAGATGGAA
AAAATTATCAGAATTGGCAGACGCATACAGTAGAGTTGGTGAGCTACCCTTGTGAAATGGACGATAAAGC
TGCCGTTGAAACACGCAAACAAGCCATGTTGTGGTTAGCAACCCACTTTACTACGCATATCGACCAGTCC
AATCATCAACCATTAGCTCCTATTCAAAGTGAAGACGGACGCTTTGTTATCGAAATCACTAATGCGAAGC
ATGTGATTGCTGCGGGCAATGGGATTTCTGCAGAATCTCAAGGTCAAACAATCACGATGACACCAAGTGG
ACAACAAGCCACAGTGGGTGTTGCTGCTAAAGGTTTCGGGACGAGTGCAACGCCAGAATTAAGGTTACTT
GAATCGGCACCTTGGTATCAGAAATCACTCAAGAGCCAATTTGCATCTCTAACGAGCGCAGAAAACTTGG
ATGATAAAGAGTTAGCTGCAAACGTATTTGCTTATCTGACGTCTATTTATTTAAAAACAGCAGAGCTAGC
GAAGAAGTTTGGTATTTACATCAATGAATGGGACCCCATGTCGGAGCAAATTACTCCAAATGCGAATGGA
TTAACGGATCCAAAAGTAAAAAATGCATGGGAAATATTGCCACGTACAAAACCAAGCAAAATAGTAGAAA
TACTCAGTAAGAGTGATGCCAAAGCGGTTATGAAACATATCAAGCCTCAATTGCAGTCTCGCTATTCTGA
GAGTTTGTCGAAAAATGTATTTCAATATTTCCAAGATGGTGGTGAAGTAGCCGGACACGGTATTAATAAT
GCGACGGTCGGTGATAAACATAGTCCGGAATTGGCGATTTTGTTTGAGTTCAGAACTGTTCCGAATGAAC
TGCAAAGTTATTTGCCTAAAACAGAATCGACAACTAAGTCAGAAGTGAAGTTACTCGATCAGTTTGATCC
TATGAAGCGTAAAACAGTAATTCAACAAGTAGAATCGCTTGTGCAAAATAGTGGCGATGCATTTGATAAA
TGGTACCAAAGCTACCGAGACTCCATGAATCAACCTCCCGTTAAAAATGCGAAGAAAATTGCTTCCGCGA
ATCAAAAAGCACAATGGGTTAAAGAGCATAATCCTCAAGAATGGCAACGCATTATTGCTTAG