SecReT6
Effector Protein ID: 237807118
-
SecReT6 ID337
T6SS typeA1
Gene symbol-
Locus tagTola_0342
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]385297..385815 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDC4L973
KEGG IDtau:Tola_0342
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.50E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|237807118|ref|YP_002891558.1| type VI secretion system effector [Tolumonas auensis DSM 9187]
MPTPAYMTINGEKQGLITAGTFTEASVGNIYQEGHEDEVMVQGFEHQVVLPRDPQSGQPSGQRVHKPVKI
TKVFDKCSPLIYNSLTSGERLPSVKIKWYRTSAAGTQEHYFTTELTDAIVVDVQASMPNCQDPSQAHFTH
LEDVFMTYRAIKWTHEVSGTSGSDDWRSPTTA
-
Nucleotide Sequence: 519 bp     [Download]
>ref|NC_012691.1|:c385815-385297 type VI secretion system effector [Tolumonas auensis DSM 9187]
ATGCCAACTCCCGCGTATATGACTATCAATGGTGAAAAACAAGGTCTGATCACTGCCGGTACTTTTACCG
AAGCCTCTGTCGGTAACATCTATCAGGAAGGTCATGAAGATGAAGTGATGGTTCAGGGTTTTGAACATCA
GGTCGTTCTGCCACGTGATCCGCAATCAGGCCAGCCATCCGGTCAACGCGTTCATAAACCAGTAAAAATC
ACCAAAGTTTTCGATAAATGCTCCCCGTTGATTTACAACTCACTGACCTCCGGTGAGCGTCTGCCCAGCG
TGAAAATCAAATGGTACCGGACTTCAGCGGCAGGTACTCAGGAGCATTACTTCACGACTGAACTGACTGA
TGCCATCGTGGTTGACGTGCAGGCCAGCATGCCAAACTGTCAGGATCCATCGCAGGCTCATTTCACTCAC
CTGGAAGACGTATTCATGACTTACCGGGCAATCAAATGGACACATGAAGTCTCTGGTACTTCTGGTTCTG
ATGACTGGCGTTCGCCAACTACAGCCTAA