SecReT6
Effector Protein ID: 237811881
-
SecReT6 ID489
T6SS typeA4b
Gene symbol-
Locus tagGBP346_A1621
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]1557437..1560244 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDC4KVT7
KEGG IDbpr:GBP346_A1621
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.70E-46, Aligned region: 37..356
DUF2345 [PF10106], Evalue: 2.80E-44, Aligned region: 742..903
T6SS_Vgr [PF13296], Evalue: 2.10E-31, Aligned region: 579..687
Phage_base_V [PF04717], Evalue: 1.60E-18, Aligned region: 158..184
Phage_base_V [PF04717], Evalue: 1.60E-18, Aligned region: 423..520
Protein Sequence: 935 a.a.     [Download]
>gi|237811881|ref|YP_002896332.1| Rhs element Vgr protein [Burkholderia pseudomallei MSHR346]
MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQWDVYALATDPGLDLDAMLGQRVTIR
TALANGTSAVRSGLVAQAECIGYDAGLARYCLQLVPWLAALAHGRNERTFVRQGVADVLGAVFAPYGAIA
RWRFTADANQRIAELGARDYRVQYRTHTHFDFVRHVLAEAGLGFCFVEEADAPAGHTMLIFDDSTQLPED
ETSARMGGVPQRLSGTATEPDDVIVGIGQSLSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDV
GPEAFDSLREADAAARRHADAIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAQAPDAFVLTRVD
QIGINNLPATVMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHWQADGDAGTYPTRAMQRLASEGHGLQQTPRIGH
EVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTPGGEAGQPLDESVYAQASDHAASAQGNLAGGHSPAWHG
AGGGAKRHDHAGALSGFKSQGFDGQGYNQLVADDTDRMGRMQMATTHAATQLNIGHLRHQADNYLGSFRG
QGVELRSDAYGALRGARGVLISSYAPTGPSQPAGDASALQSLLAQQAALAKLLDKSADTHKTLPFAAQRG
AQRAGQSSMNGDAAPLDALGKSFATTVGADGYAQASADASRRATGNALPHTGDAVLGVEAKGGQGLLAGQ
SLQWAAGETLTIGSGNDTNLAVNRTLRVHSGQGIGWLAGANGANGAQGVGMSVIAGKDDLALQAQHDLMA
LRARDDLRVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVGPDQLAPALPQ
FPEKVCVECLKHAMQSGSALAGKAI
-
Nucleotide Sequence: 2808 bp     [Download]
>gi|237810278|ref|NC_012695.1|:1557437-1560244 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGAGCGTGATCACGCAATTCACGTCGCTTTTCAGCGCTGCCAATTGTCTCTATTGCCTCGACGGTCCGG
GCGAAATCGCGTCGCTGCAGATCGAGCGCTGGGTGGGGCGAGAGACGCTCTCCGAGAACTTCCAGTGGGA
TGTCTACGCGCTCGCGACCGATCCCGGCCTCGACCTCGACGCGATGCTCGGGCAGCGCGTGACGATCCGC
ACGGCGCTCGCGAACGGCACGAGCGCCGTGCGCAGCGGGCTCGTGGCGCAGGCCGAGTGCATCGGCTACG
ACGCCGGCCTCGCGCGCTACTGCCTGCAGCTCGTGCCGTGGCTCGCCGCGCTCGCGCACGGCCGCAACGA
GCGTACGTTCGTGCGGCAGGGCGTCGCCGACGTGCTCGGCGCGGTGTTCGCGCCGTACGGCGCGATCGCC
CGCTGGCGCTTCACCGCGGACGCGAACCAGCGCATCGCGGAACTCGGCGCACGCGACTACCGCGTGCAGT
ACCGCACCCACACGCATTTCGATTTCGTCCGGCACGTGCTTGCCGAAGCGGGTCTCGGCTTTTGCTTCGT
CGAGGAGGCGGACGCGCCCGCGGGCCACACGATGCTGATCTTCGACGACAGCACGCAGTTGCCCGAGGAC
GAGACTTCCGCGCGCATGGGCGGCGTGCCGCAGCGGCTGAGCGGCACGGCGACCGAGCCGGACGACGTGA
TCGTCGGCATCGGGCAGTCGCTGTCGCTGACCGCGGATCGTGTCACGCTGATCAGCAGCGACTACCGCGG
CAACCAGTCGACGAGCGCGACGGCGAGCCTCGGCAATCCGGCCGGATCGCGCGAGCTGTACGACGACGTC
GGGCCGGAGGCGTTCGACAGCCTGCGCGAGGCCGACGCCGCCGCGCGGCGGCACGCGGACGCGATCGTCT
CGGCGGCGCGCTTCTGGACAGGCTACGGCACGTTGCGCACCGCGCGCGCCGGCCGCGCGCTGCGCATCGC
GGGCGCGACGTGGCGCATGTCGCGCGGCGGCGCGCAGGCGCCCGATGCGTTCGTGTTGACGCGCGTCGAT
CAGATCGGCATCAACAATTTGCCCGCGACGGTGATGGAGCGCGTCGAGCGCAGCCTCGGCCCGCTGCCGC
CCGCGAATCTCGACGCGCGCGTGCTCGCGCAGGCGAAGGCGGGCGGCTATGCGAACCGGTTCGACGCCGC
GCCGCGCGACCAGGCATGGCGCCCGACGCTGGAGGACGGCACCGGCCAGCGACTGAACCCGGTGCCGACG
GCGCTCGGCGCGCAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGACGCGGCCGGGCTCGACGGGCCCGG
TGCATACCGACGCGCAGGGCCGGTTGCGGCTGCGCTATCACTGGCAGGCGGACGGCGACGCGGGCACCTA
TCCGACGCGCGCGATGCAGCGGCTCGCGAGCGAGGGGCACGGGCTGCAGCAGACGCCGCGGATCGGCCAC
GAAGTGCTCGTGCAGTTCGTCAACGGCCTCGTGCACCGGCCGATCGTGCTCGGCGGGCTGTTCAACGGCC
GCGGCGAGGGCGGCGAAGCGCCGACGCCCGGCGGCGAAGCGGGGCAGCCGCTCGACGAATCGGTCTACGC
ACAGGCGAGCGACCACGCGGCGAGCGCGCAGGGCAATCTTGCGGGCGGCCATAGCCCCGCGTGGCACGGC
GCGGGCGGCGGCGCGAAGCGCCACGATCACGCGGGCGCGCTGTCCGGCTTCAAGAGCCAGGGGTTCGACG
GCCAGGGCTACAACCAGCTCGTCGCGGACGATACCGATCGCATGGGCCGCATGCAGATGGCGACGACGCA
CGCGGCGACCCAGCTCAACATCGGCCACTTGCGGCATCAGGCCGACAACTATCTCGGCAGCTTCCGCGGG
CAAGGCGTCGAGCTGCGCTCGGACGCGTACGGCGCGCTGCGCGGCGCGCGCGGCGTGCTGATCTCCAGCT
ATGCGCCGACGGGGCCGTCGCAGCCGGCGGGCGATGCGTCGGCGCTGCAGTCGCTGCTCGCGCAACAGGC
GGCGCTCGCGAAGCTTCTCGACAAATCGGCGGACACGCACAAGACCTTGCCGTTCGCCGCGCAGCGTGGC
GCGCAGCGGGCCGGACAGTCGTCGATGAACGGCGACGCCGCGCCGCTCGACGCGCTCGGGAAGAGTTTCG
CGACGACGGTCGGCGCCGACGGCTACGCGCAGGCGTCGGCCGACGCATCGCGCCGCGCGACGGGCAATGC
GCTGCCGCATACCGGCGACGCGGTGCTCGGCGTCGAGGCGAAGGGCGGCCAGGGGCTGCTGGCCGGCCAG
TCGCTGCAATGGGCGGCGGGCGAGACGCTGACCATCGGCAGCGGCAACGACACCAACCTCGCGGTCAACC
GGACGTTGCGCGTGCACAGCGGGCAGGGCATCGGCTGGCTTGCCGGCGCGAACGGCGCGAACGGCGCGCA
GGGCGTCGGCATGAGCGTGATCGCCGGCAAGGACGATCTGGCGCTGCAGGCGCAGCACGACCTGATGGCG
CTGCGCGCGCGCGACGATCTGAGGGTCGCGTCGATCGGCGCGGATGTCGAGATCGCGGCGAAGCAGACCG
TGCGGCTCGCGGTCAGCGGCGGCGCGCATCTGACGATCGAAGGCGGCAACGTCACGTTCGGCTGCCCGGG
CTCGCTCGTCGTTCATGCGGCCCAGCATACGTTCGTCGGGCCGGATCAACTGGCTCCCGCGCTGCCGCAG
TTTCCCGAGAAGGTGTGCGTCGAATGCCTGAAGCACGCGATGCAATCGGGCAGCGCACTGGCCGGCAAGG
CGATCTGA