SecReT6
Effector Protein ID: 237811885
-
SecReT6 ID489
T6SS typeA4b
Gene symbol-
Locus tagGBP346_A1625
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]1562361..1564769 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDC4KVU1
KEGG IDbpr:GBP346_A1625
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 3.30E-55, Aligned region: 42..137
DUF2235 [PF09994], Evalue: 3.30E-55, Aligned region: 260..281
DUF2235 [PF09994], Evalue: 3.30E-55, Aligned region: 285..409
Protein Sequence: 802 a.a.     [Download]
>gi|237811885|ref|YP_002896336.1| hypothetical protein GBP346_A1625 [Burkholderia pseudomallei MSHR346]
MSYRFASADRFDVNVVTKDEQDAILRRLHEDDGMACCKTLHIGIFFDGTRNNADRDRGARTESNVARLYA
AFPIDKYHQAIYVAGVGTPFVEQIGDFGVGLQAAAGAAAGWAGEGRINWALLRIHDILHAYVHGQTLTAV
LGKRYEELVKSMSLDMNFKGIDLGGTPPKPGSFGDIKLRANSGVGALKLIAAEQNGVELTWDLDTNWAQL
KNELDSSKWNAAVQEWDAKRRKVLLDRRAQLKARIGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWL
ADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWGRKELMAVPHYVRRCVHMVAAHEP
RGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDDADKLSQVPLLDMYREARKAGVPLDING
PGIGADVIAAFKVSAGLKQAFAAYVKKSENYYYEKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAA
QARYPQDAADLDSANAELKEEWNDLLEVEKAGGPTITRYVEKFVTKWASENPKTAAVVSTSLLPAAVAAE
IFVPGVSAATVLFGDKVVKLVQAQLKEKWEQWLQVRSDWNMGPPEPAISALYDNYMHDSRAWFKPLGDDD
DVWNHRQIQELKTKQASFERAHAAWKKRVEMGMPSPLQVTQAMGVGSTGWGPVGGLPPEPEPRSPLTAQQ
ADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWD
QPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 2409 bp     [Download]
>gi|237810278|ref|NC_012695.1|:1562361-1564769 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGAGTTATCGTTTCGCATCCGCCGACCGATTTGATGTTAATGTCGTTACGAAAGACGAGCAGGACGCTA
TTTTGCGGAGGCTGCATGAAGATGACGGCATGGCTTGTTGTAAGACATTGCATATCGGAATCTTCTTTGA
TGGTACGCGTAACAACGCTGATCGGGATAGGGGGGCGCGAACGGAAAGCAATGTGGCACGGCTTTATGCC
GCTTTTCCAATAGATAAATATCACCAAGCGATTTACGTTGCTGGAGTTGGCACGCCTTTTGTCGAGCAGA
TTGGTGATTTCGGTGTTGGCTTACAGGCGGCCGCAGGAGCTGCGGCAGGTTGGGCGGGAGAGGGGCGAAT
TAACTGGGCTTTGCTTCGGATTCACGATATTTTGCATGCGTATGTTCACGGTCAGACGTTAACGGCAGTG
TTAGGAAAGCGCTACGAGGAACTCGTAAAATCGATGAGCCTCGATATGAATTTTAAGGGCATCGACCTTG
GCGGAACGCCGCCTAAACCGGGAAGCTTCGGCGATATCAAATTGCGTGCCAATTCTGGTGTGGGGGCGCT
CAAGCTGATTGCTGCCGAACAGAATGGTGTCGAGCTGACTTGGGATTTAGATACGAATTGGGCGCAGCTC
AAAAACGAGTTGGATTCGTCGAAGTGGAATGCAGCCGTGCAAGAATGGGACGCCAAGCGCCGCAAGGTAT
TGCTCGATCGTCGTGCTCAGCTAAAAGCGCGCATCGGTGATCTGCTGGTCAAGGGGAAGCCGAAGCTGCA
ACGCATTCGGCTATACGTATTCGGTTTTTCGCGCGGCGCAGCGGAGGCTCGCACTTTCTCGAACTGGCTT
GCTGACGCGCTTGACCCCGATTTCAGTTTGTGTGGAGTGCCGGTTTCATACGATTTTCTCGGCATCTTTG
ATACGGTCGCATCGGTCGGCATCGCTCAGAGCGCCGCCGCAACATTATTCGACGGACATGGAGGATGGGG
GCGCAAGGAACTGATGGCCGTGCCGCATTATGTGCGCCGTTGCGTGCACATGGTGGCGGCACATGAACCT
CGTGGATCATTTCCGCTCGACCTTATCGATTGTTCGATGGACGGTCGTGAGGAGATTGTCTACCCGGGTG
TTCACTCGGACGTCGGCGGCGGCTATGGGCCGGGCGAACAGGGGCGCGGTCGGGACGACGCCGACAAACT
TTCGCAAGTCCCGCTGCTTGATATGTACCGGGAGGCGCGTAAGGCAGGTGTGCCCTTGGATATCAATGGG
CCGGGTATCGGCGCGGACGTCATCGCTGCATTCAAGGTTTCAGCAGGGCTAAAACAAGCCTTCGCAGCCT
ACGTAAAAAAGAGCGAGAACTATTATTACGAGAAAGATCACGGCACGCCGGGCCTAATGCGTTGCCATTA
CGGCTTGTATCTCCGGTGGCGCAAGATGCGGCTCAAGGACATGCATGCACAGCCCAGCTTCAAGGCTGCG
CAGGCGCGCTATCCGCAAGATGCAGCGGATCTGGACAGTGCGAACGCGGAATTGAAGGAGGAGTGGAACG
ATTTGCTGGAGGTCGAGAAAGCTGGCGGCCCGACAATCACCCGATACGTGGAGAAGTTTGTTACGAAATG
GGCCAGTGAGAATCCGAAAACGGCCGCCGTCGTTTCCACGTCTCTACTTCCGGCCGCGGTCGCTGCTGAG
ATTTTTGTTCCGGGGGTTAGCGCTGCGACGGTTCTATTCGGCGACAAAGTGGTGAAACTGGTGCAAGCCC
AACTCAAGGAGAAGTGGGAGCAGTGGCTGCAAGTTCGCAGCGACTGGAACATGGGGCCGCCTGAACCTGC
GATCAGCGCACTCTACGACAACTACATGCACGACTCCCGCGCATGGTTCAAGCCGCTCGGCGACGATGAC
GACGTGTGGAACCATAGGCAGATTCAGGAACTCAAGACCAAGCAAGCCAGCTTTGAACGCGCCCATGCTG
CCTGGAAAAAGCGTGTCGAAATGGGCATGCCAAGCCCGTTGCAGGTTACACAGGCAATGGGCGTAGGTTC
CACAGGATGGGGGCCCGTCGGCGGGCTTCCGCCCGAACCCGAACCCCGCTCCCCGCTCACCGCCCAGCAA
GCCGATCTGCTCAAGCGCTACGACGCCGCGATGCAGTCCGCCAAGCAGGCACGCGCCGCAAAGGACCCGA
ACGCGCCGACGGACAGCGCCGTGCTGACCGATCCGAAGGTGACGGGCGGCCTCGCGCTGCAAACCAGCGG
CCGCGAGTTCTATTTCCTGTGGGGCTTCCTGCGCTGGCGGACCGTGTTCGTGAACGGCGTGCGCTGGGAC
CAGCCGCGCGTGCCGACGGTGCAGGAGGAAATGGAGGGCATGCGCATGCAGATGCAGCGCCAGGTCGACA
TGAAGGGCATCGGCGTACTGTTCCAATGA