SecReT6
Effector Protein ID: 237811886
-
SecReT6 ID489
T6SS typeA4b
Gene symbol-
Locus tagGBP346_A1626
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]1564878..1568213 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDC4KVU2
KEGG IDbpr:GBP346_A1626
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-51, Aligned region: 35..340
Phage_GPD [PF05954], Evalue: 6.20E-51, Aligned region: 668..770
DUF2345 [PF10106], Evalue: 1.70E-48, Aligned region: 588..636
DUF2345 [PF10106], Evalue: 1.70E-48, Aligned region: 667..820
T6SS_Vgr [PF13296], Evalue: 8.30E-31, Aligned region: 516..623
T6SS_Vgr [PF13296], Evalue: 8.30E-31, Aligned region: 693..720
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 384..497
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 576..589
Protein Sequence: 1111 a.a.     [Download]
>gi|237811886|ref|YP_002896337.1| Rhs element Vgr protein [Burkholderia pseudomallei MSHR346]
MDLVAALTGYSQTTRHIRIDTAMPGAFVVERFHGREGVNESFRFEIDVLSSEPFLDLTPLIGHAARLRLA
TGAGERSWNGYVTHAAYADSDGEITRYRLTMESWLALLRLRRNCLYFVDVDTKDICERVFGDYPQARRRY
ELKEPLRKFSLRGQYRETDDTFVLRQLAEAGLSFRIEHAQDAGKEASGDHTVVVFDRRAPFRHGSTIAYN
LQDVGDPDGVITQFSERHQMVPDRVVATSWKADELLALAGHAQQPPEDKAPVLPVREIYDGQRAGRFDTI
DDAQRFAEQRLDALRLPKRIHYGAGSSRTLEIGAVHTLAGYLDRAITFVPLSIEHEAVNNLGADIGALLG
RGELDKGLYRNRFVAVPDGTPIVPPHRDRPIVHGVQTAIVVGEAGSRVSSTRDHQVRVQFPWMRGTAPLP
GGLTDTASRSNPAGHAPGDHRSGVLARVAESSAGPNFGHAFTPRVGAEVVIGFESGNIDMPVVLGQVYGG
RVQPPFAAGEGSDANHPGTLTGLQTQTLDGQSGSRWVMDDAAGQLRHELSNSTANSRLAQGYLIDQQGAM
RGAYRGEGFELATDGWGVVRAGEGVLVSSTARRLATSTQMDVAQSVGQLKQAVRTAQGMSESAAAAHAGG
LAANAAQADFLKAIDPAQDGKYTGAVNGQSATKASGAQRDGGEPVERFAAPAVLMESPENIVLTTPHSAV
SYAAQHVHLTAQRDAHVAAAATVAAASGDAVSLYAAAGGLRAIASDGPVSVEAHTSTMEILADQSVRITS
TDDRIDVLAKDAIVLQQGPNRITLKGGDITVETPGQFLVKSGAHPFPGPAAQSVSLPPLPIPAPLALFDE
QIRFVNEDGEPLGNVAYQLKLADGSTVSGVTDDNGRTERVSTDGPTAIQSATLTPTQVVDCCGRTSDVPP
PAVKVDIKGVGTHDTLVGSSEQSVTVKGESRPLTDGEIEMAKTVFQDSIDYSAVRVHKGSYFWFNLQSKR
TAVTPNNTMYFREEDFVEDFSVVSEEYPRRGWFMHEMTHVWQHQRGYAVRWHALTVTIRGESAYRYEIEP
GQVFSDFNMEQQGNLVSDYFALIVVDNRGELIHAQPGSKNQLRQVLAPLLQDPKDASNLPK
-
Nucleotide Sequence: 3336 bp     [Download]
>gi|237810278|ref|NC_012695.1|:1564878-1568213 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGGATTTAGTCGCCGCATTGACGGGCTATTCTCAAACGACTCGCCACATCCGGATCGACACGGCGATGC
CGGGCGCGTTCGTGGTCGAACGTTTCCATGGGCGCGAGGGCGTCAACGAATCGTTTCGCTTCGAGATCGA
CGTGCTGTCGAGCGAGCCGTTTCTCGATCTGACGCCGCTCATCGGCCACGCGGCGCGGCTGCGTCTCGCG
ACGGGCGCGGGCGAGCGCAGCTGGAACGGCTATGTGACGCATGCGGCGTATGCGGACAGCGACGGCGAGA
TCACCCGCTATCGCCTCACGATGGAGTCGTGGCTCGCGCTGTTGCGCCTGCGTCGCAATTGCCTGTACTT
CGTCGACGTCGACACGAAGGACATCTGCGAGCGCGTGTTCGGCGATTATCCGCAAGCGCGTCGGCGCTAC
GAACTGAAGGAACCGCTGCGCAAGTTCAGCCTGCGCGGCCAGTACCGGGAGACCGACGACACGTTCGTGC
TGCGCCAGCTCGCCGAAGCCGGCCTGTCGTTCAGGATCGAGCATGCGCAGGATGCGGGCAAGGAAGCGTC
GGGCGACCATACGGTCGTCGTGTTCGATCGGCGCGCGCCATTTCGGCACGGCAGCACGATCGCATACAAC
CTGCAGGACGTCGGCGATCCGGACGGCGTGATCACGCAGTTTTCCGAACGCCATCAGATGGTGCCGGACC
GGGTCGTCGCGACGAGCTGGAAAGCCGACGAATTGCTCGCGCTCGCCGGGCACGCGCAGCAGCCGCCCGA
GGACAAGGCGCCGGTGCTGCCCGTGCGCGAAATCTACGACGGCCAACGCGCGGGCCGCTTCGACACGATC
GACGACGCGCAGCGCTTCGCCGAGCAGCGGCTCGACGCGCTGCGCCTGCCGAAGCGGATCCATTACGGCG
CGGGCTCGTCGCGCACGCTCGAGATCGGCGCGGTCCATACGCTCGCCGGTTATCTGGACCGTGCGATCAC
GTTCGTGCCGCTGTCGATCGAGCACGAGGCGGTCAACAATCTCGGCGCCGACATCGGCGCGCTGCTCGGG
CGCGGCGAGCTCGACAAGGGGCTGTACCGCAACCGTTTCGTCGCGGTGCCCGACGGCACGCCGATCGTGC
CGCCGCATCGCGATCGGCCGATCGTGCACGGCGTGCAGACCGCGATCGTCGTCGGCGAGGCCGGCAGCCG
CGTCAGCAGCACGCGCGATCATCAGGTGCGCGTGCAGTTTCCGTGGATGCGCGGCACGGCGCCGCTGCCC
GGCGGCCTGACCGACACGGCGAGCCGCTCGAATCCGGCCGGGCACGCGCCGGGCGATCATCGCTCGGGCG
TGCTCGCGCGCGTCGCGGAATCATCGGCCGGGCCGAACTTCGGGCATGCGTTCACGCCGCGCGTCGGCGC
CGAAGTGGTGATCGGCTTCGAGTCGGGCAACATCGACATGCCCGTCGTGCTCGGCCAGGTCTACGGCGGG
CGCGTGCAGCCGCCGTTCGCGGCGGGCGAAGGCAGCGACGCGAACCATCCGGGCACGCTGACCGGCCTGC
AGACGCAAACGCTCGATGGCCAGTCCGGCAGCCGCTGGGTGATGGACGACGCCGCGGGACAACTGCGGCA
CGAGCTGAGCAACTCGACCGCGAACAGCCGGCTCGCGCAGGGTTATCTGATCGATCAGCAGGGCGCGATG
CGCGGCGCGTATCGCGGCGAAGGCTTCGAGCTCGCGACCGACGGATGGGGCGTCGTGCGCGCGGGCGAAG
GCGTGCTCGTATCGAGCACGGCGCGGCGGCTCGCGACGTCGACGCAGATGGACGTCGCGCAAAGCGTCGG
ACAACTGAAGCAGGCGGTGCGGACCGCGCAGGGCATGAGCGAATCCGCCGCCGCGGCGCACGCGGGCGGG
TTGGCCGCCAATGCCGCGCAGGCGGATTTCCTGAAGGCGATCGATCCGGCGCAGGACGGCAAGTACACGG
GCGCGGTCAACGGGCAGAGCGCGACGAAGGCGAGCGGCGCGCAGCGCGACGGCGGGGAGCCGGTCGAGCG
CTTCGCCGCGCCGGCGGTGCTGATGGAGTCGCCGGAGAACATCGTGCTGACGACGCCGCACAGCGCCGTC
TCGTATGCGGCGCAGCACGTGCATTTGACCGCGCAGCGCGACGCGCACGTAGCGGCCGCCGCGACGGTCG
CGGCCGCGTCGGGCGATGCCGTGAGCCTGTATGCCGCCGCGGGCGGCCTCCGGGCGATCGCGAGCGACGG
GCCGGTGAGCGTCGAGGCGCATACGTCGACGATGGAGATTCTCGCGGATCAGTCGGTGCGCATCACGTCG
ACCGACGATCGCATCGACGTGCTCGCGAAGGACGCGATCGTGCTGCAGCAGGGGCCGAACCGGATCACGC
TGAAGGGCGGCGACATCACGGTCGAGACGCCGGGGCAGTTCCTCGTGAAGTCGGGCGCGCATCCGTTTCC
GGGGCCGGCCGCGCAGAGCGTTTCACTGCCGCCGCTGCCGATTCCCGCGCCGCTCGCGCTGTTCGACGAA
CAGATTCGCTTCGTCAACGAAGACGGCGAGCCGCTCGGCAACGTCGCGTACCAGCTGAAGCTCGCCGATG
GCTCGACCGTGTCGGGCGTGACCGACGACAACGGCAGAACCGAGCGCGTATCGACGGACGGGCCGACGGC
GATCCAGTCGGCGACGCTCACGCCGACGCAGGTCGTCGACTGCTGCGGGCGAACCTCGGATGTGCCGCCG
CCGGCGGTGAAGGTCGACATCAAGGGCGTCGGCACCCATGACACGCTGGTGGGCAGCTCGGAGCAATCGG
TCACGGTCAAGGGCGAGAGCCGGCCGCTGACCGACGGCGAGATCGAGATGGCGAAAACCGTGTTTCAGGA
CAGCATCGATTACAGCGCGGTGCGCGTGCACAAGGGCAGCTATTTCTGGTTCAACTTGCAGAGCAAGCGT
ACGGCCGTGACGCCGAACAACACGATGTATTTCCGCGAAGAGGATTTCGTGGAGGATTTTTCGGTTGTCA
GCGAGGAGTATCCGAGGCGGGGTTGGTTCATGCACGAAATGACGCACGTTTGGCAACATCAACGAGGATA
TGCCGTGCGCTGGCATGCGCTTACCGTGACGATTCGCGGCGAGAGCGCGTATCGGTACGAAATCGAGCCC
GGGCAAGTCTTCAGCGATTTCAATATGGAGCAGCAAGGCAATCTTGTATCAGACTACTTTGCGCTCATTG
TCGTGGACAATCGAGGTGAATTGATTCATGCGCAACCAGGAAGCAAGAATCAACTTCGCCAAGTGCTGGC
CCCACTTCTACAGGATCCCAAGGATGCATCGAATCTTCCGAAATAG