SecReT6
Effector Protein ID: 237811891
-
SecReT6 ID489
T6SS typeA4b
Gene symbol-
Locus tagGBP346_A1631
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]1570357..1573191 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2693
Descriptiontype VI secretion system Vgr family protein
UniProt IDC4KVU7
KEGG IDbpr:GBP346_A1631
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-61, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 2.50E-61, Aligned region: 587..608
DUF2345 [PF10106], Evalue: 1.40E-40, Aligned region: 748..912
T6SS_Vgr [PF13296], Evalue: 8.10E-26, Aligned region: 587..690
T6SS_Vgr [PF13296], Evalue: 8.10E-26, Aligned region: 795..832
Phage_base_V [PF04717], Evalue: 5.90E-12, Aligned region: 442..546
Protein Sequence: 944 a.a.     [Download]
>gi|237811891|ref|YP_002896342.1| Rhs element Vgr protein [Burkholderia pseudomallei MSHR346]
MSIPTDVLQALFGGWSQHDRFLWITTPLGANALVAESLHGWEALDDGGFRLQLTALAEHPSLPLAQLIGA
PILIEWQAQEGRDARRPFHGHVIAAELVGYNGGLARVRLVVEPWLTLLRQRVDSYNYLDASVVEISEQVF
RRYARGAIAPAWRWALADAAKYPKRSLTAQAGESDFDFLERLWAEEGIFYWFEHEGDARASSLGKHTLVL
ADSNQRFAPDEPEIVGFHQTSDDDPQGCIQHFMHARRWRIGSVARASWDHRSLSTRPTGARANGAVAPGE
DRDVAGPYAYQTGAIGDRRAQQQLDAQRVAALRSEGRSTRRDLRPGLRFAIAHHPTLGVSDAFICLRVEH
SARANVDATVRSAIEQRLGAIASIAGAAPVPHGPASALNAALGADTHHGGSLMRDDAVYRNRFVALPAEQ
TYRPLAASGHGARMHPVAVMPGAQTAIVVGAGDPVHTDRDHRIRIQHHAQRGENAASRDDHPHAANAPAN
RGAGTWTRMMTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYNGRGNAHAQHNAQAGGPSGST
GNAAAWFAGNAHAAVLTGFKTQDMSMSQQGTGGYRQFMLDDTAGQSSARLYTTDRNSGLTLGHVKQTQDN
RRQADRGYGAELATDAAGALRGGAGLLISTAPGVSQMDASAPSQVLAQHRQTLQSLAALAHKQGAEPGGA
VPEAAGGAGAASASTGAAADKPLPAVDGIEQSREAIGATREGSGGDTAGGGGGGAIAWSKPHLVAHGEAG
LAAMSAKSHVWVSGTETVLSAGQDVQLTAKGKTSVVANHGISLYTQGAAGDGRPVAGRGIALHAASGAVS
MQAQNAGKLSASAQKAVTLASAQGSASVQAQQRVLLSAAKAYLKMEGNDIVVGAPGRADFKAAAHQLTGP
KSAGAQSTLGKGASRDCPQTMGDMISSSAAFADL
-
Nucleotide Sequence: 2835 bp     [Download]
>gi|237810278|ref|NC_012695.1|:1570357-1573191 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGTCGATCCCCACTGACGTTCTGCAAGCACTCTTCGGCGGCTGGTCGCAACACGACCGCTTTCTCTGGA
TCACGACGCCGCTCGGCGCGAACGCGCTCGTCGCGGAAAGCCTGCACGGCTGGGAGGCGCTCGACGATGG
CGGCTTCCGTTTGCAGCTCACCGCGCTCGCCGAGCATCCGTCGCTGCCGCTCGCGCAACTGATCGGCGCG
CCGATCCTGATCGAATGGCAGGCGCAGGAAGGGCGCGACGCGCGCCGGCCGTTCCACGGCCACGTGATCG
CCGCCGAGCTCGTCGGCTACAACGGCGGCCTCGCACGCGTGCGGCTCGTCGTCGAGCCGTGGCTCACGCT
GCTGCGGCAGCGCGTCGACAGCTACAACTATCTGGACGCGAGCGTCGTCGAGATCAGCGAACAGGTGTTC
CGCCGTTACGCGCGCGGCGCGATCGCGCCCGCATGGCGATGGGCGCTCGCCGATGCGGCGAAGTACCCGA
AGCGCAGCTTGACCGCGCAAGCCGGCGAGTCCGATTTCGACTTCCTCGAGCGGCTCTGGGCGGAGGAGGG
CATCTTCTACTGGTTCGAGCACGAAGGCGACGCGCGCGCATCGAGCCTCGGCAAGCACACGCTCGTGCTC
GCCGATTCGAATCAGCGCTTCGCGCCGGACGAACCGGAGATCGTCGGCTTTCATCAGACGAGCGACGACG
ACCCGCAAGGCTGCATCCAGCACTTCATGCACGCGCGGCGTTGGCGCATCGGCAGCGTCGCGCGCGCGAG
CTGGGATCACCGCAGCCTGTCGACGCGTCCGACGGGCGCGCGCGCGAACGGCGCGGTCGCGCCGGGCGAG
GATCGCGACGTCGCGGGCCCGTACGCATACCAGACGGGCGCGATCGGAGACCGGCGCGCGCAGCAGCAAC
TCGACGCCCAGCGCGTGGCCGCGCTGCGGAGCGAAGGCCGCAGCACGCGCCGCGATCTGCGGCCCGGGCT
GCGTTTTGCGATCGCGCATCATCCGACGCTCGGCGTATCGGATGCGTTCATCTGCCTACGCGTCGAGCAT
TCGGCGCGCGCGAACGTCGATGCGACCGTGCGCAGCGCGATCGAACAGCGCCTCGGCGCGATTGCGTCGA
TCGCCGGCGCCGCGCCGGTGCCGCATGGCCCCGCGAGCGCGCTGAATGCGGCGCTCGGCGCCGATACGCA
TCACGGCGGATCGCTGATGCGGGACGACGCCGTCTATCGCAATCGCTTCGTCGCGTTGCCCGCCGAGCAG
ACGTATCGGCCGCTCGCCGCATCCGGCCATGGCGCGCGCATGCACCCGGTCGCCGTGATGCCGGGGGCGC
AGACGGCGATCGTCGTGGGCGCGGGCGATCCCGTTCACACCGACCGGGATCACCGGATTCGAATCCAGCA
CCACGCGCAGCGCGGCGAGAATGCGGCGAGCCGCGACGATCACCCGCATGCGGCGAACGCGCCGGCGAAC
CGTGGCGCGGGCACGTGGACGCGGATGATGACGCCCGTGGGCGGCGATAACTGGGGTGGGGTGAGCGTGC
CGCGCGTCGGGCAGGAAGTGTGGACCGAATGGCTCGAAGGCCAGCCCGACCGGCCGGTTGCGGTGGCCGC
GCTCTACAACGGCCGCGGCAACGCGCACGCGCAGCACAACGCGCAGGCGGGAGGGCCGAGCGGCAGCACC
GGCAATGCGGCCGCATGGTTCGCCGGCAATGCGCATGCGGCGGTGCTGACGGGTTTCAAGACGCAGGACA
TGAGCATGAGCCAGCAAGGCACGGGCGGCTATCGGCAATTCATGCTCGACGATACGGCGGGCCAGTCGAG
CGCGCGCCTGTACACGACGGACCGCAACAGCGGGCTCACGCTCGGGCACGTGAAGCAGACGCAGGACAAC
CGGCGCCAGGCCGATCGCGGCTATGGCGCGGAACTGGCGACGGATGCCGCCGGCGCGCTGCGCGGCGGCG
CGGGGCTCTTGATCAGCACGGCGCCCGGCGTGAGCCAGATGGATGCGAGCGCGCCGAGCCAGGTGCTCGC
TCAGCATCGACAGACGTTGCAAAGCCTCGCGGCGCTCGCGCACAAGCAGGGCGCGGAGCCGGGCGGTGCG
GTGCCCGAGGCGGCGGGCGGAGCGGGCGCGGCGTCGGCGTCGACGGGGGCGGCGGCGGACAAGCCTTTGC
CGGCCGTCGATGGCATCGAGCAGAGCCGTGAAGCGATCGGCGCGACGCGTGAAGGAAGCGGCGGCGATAC
GGCAGGCGGCGGGGGCGGCGGCGCGATTGCGTGGAGCAAGCCGCATCTCGTCGCACACGGCGAGGCGGGG
CTGGCCGCGATGTCGGCGAAGAGCCACGTGTGGGTGTCGGGTACCGAGACGGTGTTGAGCGCCGGACAGG
ACGTGCAATTGACGGCGAAGGGCAAGACGAGCGTCGTCGCGAATCACGGCATCTCGCTGTATACGCAGGG
CGCGGCGGGCGACGGGCGGCCGGTTGCCGGCCGGGGCATCGCGTTGCACGCGGCGTCCGGCGCGGTGAGC
ATGCAAGCGCAGAACGCCGGCAAGCTGAGCGCGAGCGCGCAGAAGGCGGTGACGCTCGCGAGCGCGCAAG
GCAGCGCGTCCGTGCAGGCGCAGCAGCGCGTCCTGCTGAGCGCGGCGAAGGCCTATCTGAAGATGGAAGG
CAACGACATCGTCGTCGGCGCGCCGGGGCGCGCGGATTTCAAGGCGGCGGCGCATCAGTTGACGGGGCCG
AAGAGCGCGGGGGCGCAGAGCACGTTGGGCAAGGGCGCTTCGAGGGATTGTCCGCAGACGATGGGTGACA
TGATTTCGTCCAGCGCCGCATTCGCCGATCTATAA