SecReT6
Effector Protein ID: 237811893
-
SecReT6 ID489
T6SS typeA4b
Gene symbol-
Locus tagGBP346_A1633
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]1574214..1577237 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2691
DescriptionBTH_I2691
UniProt IDC4KVU9
KEGG IDbpr:GBP346_A1633
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1007 a.a.     [Download]
>gi|237811893|ref|YP_002896344.1| hypothetical protein GBP346_A1633 [Burkholderia pseudomallei MSHR346]
MAGSDDRCDVCKLQGLAVYPSRYAVVPKTFDAPALGPFDDKSVTGVALTQSKYGLRQLREGFVYLLYESG
PRGPFHWEVYSVAPDGTLWKQLDTASVKRVSAPQACQRKGHSASRVQYLVIEKPHQCGNVWIAFSEWPWS
QDTVKRYGGNDANAASLRKKRMQLIEPSTWISAPKPGPYSAPLTEANLQRVIEHAPAIATTAKGEPVGLL
SAELPEAVSYGDVGAFRDARLQICTSRYPWAMRNKAAAGAKLSSAAETVKGAQGSTRNTKGEPCVPLMVA
LWDGIGITHELNGFRNDAQARFLQYCDEQALRINALQWIDQAKLAVEAGARRKATFDHSPAMPGSTSWYY
PDAVAKQKAAAKTPADRQFWNDYQWMGENGVPPSYARQITQFRAAPSSPAYQDAMARARKYVEAKPRIEQ
DRAKKIDQDTVTGAEHDWAKYREKLADDTSSKKGASNGNVKRIDVFRVLYQRIQDQKQALLAQRTADVAN
WLDAPLFLAALEDYHEENGFDGIAFEFAIFHAIVGLSAERSGVAALNKLIDRLDPTKPESLVWRMVASNQ
KKSKEALKLALAKAEANKNVVLETVGEGFNVFAETSEKLKKFAEFYTKMDEMSKQAKQLNAIDQAMHDKG
VDKVVVSVGHLVFQRFPYKGADLVGLGNGVSEAIIKSVFMLRVGIKSEEVKDLVLQQAKVEPQLRSKFLG
EYQAQRRMGRSSPEAFRMATSAVAKTEGSNVLANRWSKLKVRESVGLVGVIGLIEVIGLIKLINKSDKEG
RDWAELGGACFSVAGAAAEVALKPLEAFKFEEGAKNLKIFGGYCGALAAGVGTTLDTLDAIEKWGSGERL
VSVLYFMKGMLGFGTTMAFGLTALSSSAPVFERLASNITGRQIRIVILDRIGQGITDAAARKVAIAAGER
VATVAAERVGAMVVGRGLLIMASWQIQVAIISLQFVIWYFGNDDLQNSIKDSIFGVGGKYKNTEDLKKQN
EAFDKALVAVGFKDDTASDKEEAKSHR
-
Nucleotide Sequence: 3024 bp     [Download]
>gi|237810278|ref|NC_012695.1|:1574214-1577237 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGGCGGGAAGCGACGATCGTTGCGACGTTTGCAAGCTTCAGGGGCTGGCGGTCTATCCGTCGCGCTACG
CGGTGGTGCCAAAAACCTTCGACGCGCCAGCGCTCGGACCATTCGACGACAAGAGCGTCACGGGCGTGGC
GCTCACGCAAAGCAAGTACGGCTTGCGTCAACTCCGCGAGGGTTTCGTCTATTTGCTCTACGAATCGGGC
CCGCGCGGCCCGTTTCATTGGGAAGTGTATTCAGTCGCGCCGGACGGCACGCTCTGGAAGCAGCTGGATA
CGGCGAGCGTGAAGCGGGTAAGCGCTCCACAGGCTTGTCAGCGAAAGGGGCATAGCGCGTCGCGTGTCCA
GTATCTCGTCATCGAGAAACCACATCAGTGCGGCAATGTCTGGATCGCGTTCAGCGAATGGCCGTGGAGC
CAAGACACGGTTAAGCGTTACGGCGGCAACGACGCGAACGCCGCGAGTCTGCGCAAGAAACGCATGCAAC
TCATCGAGCCTTCGACGTGGATATCCGCGCCGAAGCCGGGACCGTATTCGGCGCCGCTGACCGAAGCCAA
TCTGCAGCGCGTCATCGAACATGCGCCCGCTATCGCGACCACGGCGAAAGGCGAACCCGTCGGCCTGCTC
AGCGCGGAGCTGCCGGAGGCGGTCAGCTACGGGGACGTGGGCGCGTTTCGCGACGCTCGCCTGCAAATTT
GTACGTCGCGTTACCCGTGGGCCATGCGCAACAAGGCTGCGGCGGGTGCAAAGCTTAGTTCCGCGGCAGA
AACGGTCAAGGGCGCGCAGGGCAGTACCCGAAACACAAAGGGTGAGCCGTGCGTGCCGTTGATGGTGGCT
CTGTGGGACGGCATCGGGATCACGCACGAACTGAACGGCTTCCGTAACGATGCGCAGGCGCGTTTTCTGC
AGTATTGCGACGAGCAGGCGCTCCGAATCAATGCGCTGCAGTGGATTGATCAGGCGAAGCTCGCGGTGGA
AGCCGGTGCGCGCAGAAAGGCGACGTTCGATCATAGTCCGGCCATGCCGGGCAGTACGAGCTGGTATTAC
CCGGATGCCGTTGCGAAGCAAAAGGCGGCCGCGAAGACTCCGGCGGATCGGCAGTTCTGGAACGATTATC
AGTGGATGGGGGAAAACGGCGTACCGCCGTCATACGCCAGACAGATCACGCAGTTTCGCGCTGCGCCGTC
ATCGCCGGCCTATCAGGATGCGATGGCGAGAGCGCGCAAGTATGTCGAGGCCAAGCCGAGAATCGAGCAG
GATCGCGCGAAGAAGATCGACCAGGACACGGTTACCGGAGCCGAGCACGATTGGGCAAAGTACCGCGAGA
AATTGGCGGACGATACGTCGAGCAAGAAAGGGGCGTCCAATGGGAACGTCAAACGTATCGACGTTTTTCG
CGTCCTGTACCAGCGTATCCAGGACCAAAAGCAGGCGTTGCTCGCGCAGCGGACAGCGGATGTCGCGAAC
TGGCTGGATGCGCCGCTTTTTCTGGCGGCGCTGGAGGATTATCACGAAGAGAACGGCTTCGACGGGATTG
CGTTCGAGTTTGCCATTTTCCATGCGATCGTCGGATTGAGCGCCGAGCGAAGCGGCGTGGCCGCATTGAA
CAAGCTGATCGATCGCCTGGATCCGACGAAGCCGGAGAGCCTCGTTTGGCGAATGGTGGCGAGCAACCAG
AAGAAATCGAAGGAAGCGCTGAAGCTTGCGCTCGCGAAGGCGGAGGCGAACAAGAACGTCGTACTGGAGA
CGGTCGGCGAAGGATTCAACGTATTCGCGGAAACGTCCGAAAAGCTGAAGAAGTTCGCCGAGTTTTACAC
GAAGATGGACGAAATGAGCAAGCAAGCCAAACAGCTCAACGCCATTGATCAGGCAATGCACGACAAGGGC
GTCGACAAGGTGGTCGTCAGTGTCGGGCATCTTGTTTTTCAGCGCTTTCCGTACAAGGGGGCCGATTTGG
TGGGCCTTGGAAACGGCGTGAGCGAGGCGATCATCAAGTCCGTGTTCATGCTGCGGGTCGGCATCAAGAG
CGAAGAGGTGAAGGACCTCGTCTTGCAGCAAGCCAAGGTGGAGCCGCAGCTTCGGAGCAAGTTCCTCGGA
GAGTACCAGGCGCAGCGCCGAATGGGACGCAGTTCGCCGGAAGCCTTCCGGATGGCCACGTCGGCTGTTG
CCAAGACCGAAGGCTCGAACGTGCTGGCCAATCGCTGGAGCAAGCTCAAGGTGCGCGAGAGTGTCGGCCT
TGTGGGCGTGATCGGGCTGATCGAAGTGATCGGGTTGATCAAGCTGATTAACAAGAGCGACAAGGAAGGG
CGGGATTGGGCTGAATTGGGCGGCGCATGTTTTTCGGTGGCGGGCGCTGCGGCGGAGGTTGCGCTCAAAC
CTCTGGAAGCATTCAAGTTTGAAGAAGGAGCCAAGAATCTGAAGATTTTTGGTGGGTATTGCGGGGCCTT
GGCTGCTGGAGTAGGGACGACTTTGGATACCTTGGACGCCATAGAAAAATGGGGAAGCGGTGAAAGACTT
GTTAGTGTTCTTTACTTCATGAAGGGCATGCTCGGGTTTGGCACGACAATGGCGTTTGGCTTGACGGCGT
TGAGCTCATCAGCACCGGTTTTTGAACGTCTTGCGTCCAATATCACTGGGAGGCAGATTCGTATCGTTAT
TCTCGATCGGATCGGTCAAGGTATCACTGACGCAGCGGCACGTAAGGTCGCGATAGCAGCCGGAGAGCGA
GTCGCAACCGTAGCAGCAGAGCGAGTTGGGGCAATGGTGGTGGGCAGAGGTCTGCTGATTATGGCTAGTT
GGCAAATCCAAGTTGCTATTATTTCGCTTCAATTTGTTATTTGGTACTTTGGAAATGATGATCTTCAGAA
TTCAATAAAAGACTCCATTTTTGGGGTTGGTGGGAAATATAAAAATACAGAAGATTTAAAAAAACAGAAT
GAGGCTTTCGATAAAGCCCTGGTGGCTGTTGGGTTTAAGGATGACACTGCTTCTGATAAGGAAGAGGCGA
AATCGCATAGATGA