SecReT6
Effector Protein ID: 237814469
-
SecReT6 ID489
T6SS typeA4b
Gene symbol-
Locus tagGBP346_A4267
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]4087321..4088286 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDC4KM00
KEGG IDbpr:GBP346_A4267
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 321 a.a.     [Download]
>gi|237814469|ref|YP_002898920.1| hypothetical protein GBP346_A4267 [Burkholderia pseudomallei MSHR346]
MDARWPAYVAPPGVIDWRGRAMPRVCERAGAQRVNERARGGIPCAIFRVRSCMRDSGEQERAAHAMSDRR
AGQGAAAQTACASRAFGVFRVRVRDRLVSAYIERGCRCRRASRRPCAARMHTPARPMRARRANCTRCGIC
VELSRRLIVSRICPTIRFAWLVAAILIPLIKTEGTMPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKAPT
GSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAPVKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTKD
GGILVYDQFVTPPTPQPVQQRRLRWGAHGRSNNGDNFYVVE
-
Nucleotide Sequence: 966 bp     [Download]
>gi|237810278|ref|NC_012695.1|:4087321-4088286 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
GTGGATGCGCGGTGGCCCGCCTACGTCGCGCCGCCCGGCGTGATCGATTGGCGCGGGCGCGCGATGCCTC
GCGTTTGCGAACGCGCCGGCGCTCAACGGGTAAACGAACGAGCGCGCGGCGGTATTCCCTGCGCGATATT
CCGCGTGCGCTCTTGCATGCGCGACAGCGGCGAGCAGGAACGCGCGGCGCACGCGATGAGCGACCGGCGC
GCCGGGCAAGGCGCGGCTGCGCAAACGGCATGCGCGTCGCGCGCCTTCGGTGTTTTTCGTGTTCGTGTCC
GCGATCGGCTTGTGTCCGCGTACATTGAGCGCGGATGCCGTTGCCGTCGCGCATCGCGGCGGCCGTGCGC
GGCGCGCATGCATACGCCGGCACGGCCGATGCGCGCGCGACGCGCAAACTGCACGCGGTGCGGGATTTGT
GTTGAATTGTCGCGGCGGTTGATCGTTTCGCGCATCTGCCCGACAATCCGGTTCGCTTGGCTGGTTGCAG
CAATTCTAATTCCGCTTATAAAAACCGAGGGAACCATGCCTTACGTGTCGACCCATTACTCGAACAACGC
CAGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGACTTCGAAGCTCGCGCCTTTCGACAAGGCGCCGACG
GGCAGCGTCACGTCCGGCGTCGATCTGTGCGGCCAATGCGTGTCCTACGTGAAACGGGTCTGCCCGACGC
TGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCGGTGAAAGGCAACGCGACGATCGTCGCGGGCACCGT
GATCGCGACGTTCAACGCCGCCGGCAAGTACGACGGCCACGCGGCGATCTACGTCAGCCAGACGAAGGAC
GGCGGCATCCTGGTGTACGACCAGTTCGTGACGCCGCCGACGCCGCAGCCGGTTCAGCAACGGCGCCTGC
GCTGGGGCGCGCATGGTCGGTCGAACAATGGGGATAACTTCTATGTCGTGGAGTAA