SecReT6
Effector Protein ID: 238026063
-
SecReT6 ID343
T6SS typeA4b
Gene symbol-
Locus tagbglu_1g03910
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]403385..403888 [+]
Producttype VI secretion system protein TssD
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDC5AA67
KEGG IDbgl:bglu_1g03910
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-45, Aligned region: 5..139
Protein Sequence: 167 a.a.     [Download]
>gi|238026063|ref|YP_002910294.1| unnamed protein product [Burkholderia glumae BGR1]
MLDIYLNFGNPAIKGESQDKDHSGWIELKSWDWSVTQPRSATSSTSGGHTAERCEHSDMVFTKELDMASP
LLYQHASGGTTFDEVSIDFMRSDGDGKRVKYLEIKLKYVIISSVTPSVQKEGLPVEQFSLKYAAVQWKQT
KQNIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|339905954|ref|NC_012724.2|:403385-403888 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGTTAGATATCTATCTCAATTTCGGTAACCCGGCCATCAAGGGCGAGTCGCAGGACAAGGACCACTCGG
GCTGGATTGAACTCAAGTCATGGGACTGGTCGGTCACGCAGCCGCGCTCGGCCACCTCGTCCACCTCGGG
CGGCCACACCGCCGAGCGCTGCGAACACAGCGACATGGTGTTCACGAAAGAGCTCGACATGGCGAGCCCG
CTGCTGTACCAGCACGCATCGGGCGGCACGACCTTCGACGAAGTGTCGATCGACTTCATGCGTTCGGACG
GCGACGGCAAGCGCGTCAAGTACCTCGAGATCAAGCTCAAGTACGTGATCATCTCGAGCGTCACGCCGAG
CGTGCAGAAGGAAGGCCTGCCGGTCGAGCAGTTCTCGCTGAAGTACGCTGCGGTGCAGTGGAAGCAGACC
AAGCAGAACATCGGCGGCAACCAGGGCGGCAACACCCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGA
CCTACGCGGTCTGA