SecReT6
Effector Protein ID: 238894413
SecReT6 ID344
T6SS typeA2
Gene symbol-
Locus tagKP1_2398
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2304685..2305176 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDC4X7H2, C4X7H2
KEGG IDkpu:KP1_2398
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|238894413|ref|YP_002919147.1| hypothetical protein KP1_2398 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHDIKNPAYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2304685-2305176 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAGGGTCTGTCGACGTTC
AGGATCGTGAAGGCAGTATCGAAGTGGTGGCCCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACGCGTATTCATACGCCGTTCCTGTTCACCAAGGAGATCGACTCCTCCAGCCCC
TACCTGTACAAGGCGGTGACCACCGGCCAGACCCTGAAATCCGCCGAGTTCAAGTGGTACCGAATCAACG
ATGCCGGCCAGGAAGTGGAGTATTTCAATACCAAACTTGAGAACGTCAAGGTGGTGAAAGTGAATCCCCT
GATGCACGACATCAAAAACCCCGCCTACGAGAAGCACAACCATCTGGAACAGATTGAGCTGCGCTACGAG
AAGATCACCTGGACCTATAAAGACGGCAACATCATTCACTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA