SecReT6
Effector Protein ID: 238920627
-
SecReT6 ID346
T6SS typeA4b
Gene symbol-
Locus tagNT01EI_2739
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2633938..2634312 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEvpC
DescriptionHcp protein
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-22, Aligned region: 2..98
Protein Sequence: 124 a.a.     [Download]
>gi|238920627|ref|YP_002934142.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MESGTQGLNTGKATMSVFRITKWMDCASVKLASAAVQGQNFPSLEVEICTQAGDKFAFCIYKFTNVAISS
YDCSGASGGSDRPQETIDFAYKEVTWEYIPQDQSGKAGSKIGPEGWSLITNQKK
-
Nucleotide Sequence: 375 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2633938-2634312 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGGAGAGCGGTACCCAGGGTCTGAATACCGGTAAGGCCACAATGTCGGTATTCCGTATAACCAAATGGA
TGGACTGCGCCAGTGTCAAGCTGGCCTCGGCCGCCGTTCAGGGCCAGAACTTTCCCTCGCTGGAAGTGGA
GATTTGTACCCAGGCTGGCGATAAGTTCGCCTTCTGTATCTATAAATTTACTAATGTAGCCATCTCCAGC
TATGACTGCTCCGGGGCCTCTGGCGGAAGCGACCGCCCGCAGGAAACCATTGATTTCGCCTATAAGGAAG
TGACTTGGGAATATATTCCCCAGGATCAGAGCGGTAAGGCGGGCAGTAAAATTGGGCCCGAGGGCTGGAG
TCTTATTACCAACCAGAAGAAGTAA

Reference
(1) Rogge ML et al. (2011). Regulation of the Edwardsiella ictaluri type III secretion system by pH and phosphate concentration through EsrA, EsrB, and EsrC. Appl Environ Microbiol. 77(13):4293-302. [PudMed:21551284] experimental
 
experimental experimental literature