SecReT6
Effector Protein ID: 238920633
-
SecReT6 ID346
T6SS typeA4b
Gene symbol-
Locus tagNT01EI_2745
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2641737..2643722 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEvpI
Descriptiontype VI secretion system Vgr family protein
UniProt IDC5BAE3
KEGG IDeic:NT01EI_2745
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-81, Aligned region: 29..330
Phage_base_V [PF04717], Evalue: 4.10E-24, Aligned region: 366..458
Protein Sequence: 661 a.a.     [Download]
>gi|238920633|ref|YP_002934148.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MELTSDNRLLSLSTPLGKNTLQVVQCRGEESVSDLYRFELELFSTEPTLEWQKLVGQAAALRLALPDGQT
RYWHGVIGQASYRGAEQHGYAYYAELVPHLAWLQHAQECQIFQEKTVPQIIETVLKARGISDFRLSLSQH
YAPREYCVQYRESDLSFISRLMEEEGIFYWFDHSESHHVMVLADSNAAVQPCKTHSDIVYRPKHMSESGD
DIQLWMPSLSVVPANVFLNTYTFEQPTASLLTSTASVARQGKLSDVAVYDFTDGYTQTREGERRAKLRME
GLEAMQARIEGGGRCRTLAPGYWFSLQKHFRKDCNDDYLLLSVRHEIVNNLPWQNQEVNYQNHFVCLPKS
LPYRPLSQAPRPVIHGVQTAVVTGPQGEEIHTDLYGRVKVHFHWDRLGKQDDKSSCWIRVAQGWAGLGWG
GMQLPRVGQEVIVDFIDGNPDAPLITGRVYNANQTPPFKLPDNKTQSGIQTRSTPNGNAEHFSLLRFEDK
MGAEEVFMQSARDFRRLVKHDDELTVEHDRRVTIKNDCSETVSEGNYLQSITKGKHTRMIEGDTLTEVKS
GNSTLQVDRGDHATRVSAGSLHLEAGTSITLSVGSNRIVIDSSGVLIEGMDITVKGKQSIDASGLSVAIK
GTQSASLSSSAEVEVSSSVMTSIKGGIVKIN
-
Nucleotide Sequence: 1986 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2641737-2643722 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGGAATTAACGTCGGATAACCGGCTATTGTCCTTATCCACCCCGTTGGGCAAGAATACCTTACAGGTGG
TGCAGTGCCGTGGTGAAGAGTCGGTCTCCGACCTCTACCGCTTCGAGCTGGAGCTGTTCTCCACGGAGCC
CACCCTGGAATGGCAAAAGCTGGTCGGGCAGGCCGCCGCGCTGCGGCTGGCCTTACCGGATGGCCAGACC
CGCTACTGGCATGGCGTGATCGGCCAGGCCTCATACCGGGGTGCCGAGCAACACGGATATGCCTATTATG
CCGAGCTGGTACCGCACCTGGCCTGGCTGCAGCACGCGCAGGAGTGTCAGATCTTCCAAGAGAAGACGGT
TCCGCAGATTATTGAAACCGTACTTAAGGCTCGGGGCATCAGCGATTTTCGTCTATCCCTGTCGCAACAC
TACGCCCCCCGGGAATATTGCGTACAGTATCGCGAATCGGACCTCAGCTTTATTAGCCGGCTGATGGAAG
AAGAGGGAATCTTCTACTGGTTCGATCACAGCGAAAGCCACCATGTGATGGTATTGGCCGACAGCAACGC
CGCGGTTCAGCCCTGCAAGACGCACTCAGATATTGTCTACCGGCCAAAGCATATGAGTGAGTCCGGCGAT
GATATTCAGTTGTGGATGCCCTCTCTCTCGGTCGTGCCGGCCAACGTCTTCCTAAACACCTATACCTTTG
AACAGCCTACCGCCAGTTTGCTGACATCCACTGCCTCGGTGGCCAGACAGGGCAAATTGAGTGACGTGGC
GGTCTATGATTTTACGGACGGCTATACGCAGACCCGGGAGGGCGAACGGCGAGCCAAGCTGAGAATGGAG
GGACTGGAGGCGATGCAGGCCCGGATAGAGGGCGGCGGACGCTGCCGCACGCTGGCCCCGGGCTATTGGT
TCAGCCTGCAAAAACATTTCCGCAAAGACTGTAACGATGACTATCTGCTGTTAAGCGTACGACACGAGAT
CGTCAATAACCTGCCGTGGCAGAACCAAGAGGTGAACTACCAGAACCACTTCGTCTGCCTGCCTAAATCC
CTGCCCTACCGCCCCCTGAGCCAGGCTCCCCGTCCGGTGATCCATGGCGTACAGACGGCTGTGGTCACCG
GCCCGCAGGGTGAAGAGATCCACACCGATCTATATGGCCGGGTTAAGGTCCATTTTCACTGGGATCGACT
GGGAAAGCAGGATGATAAAAGCTCCTGCTGGATTCGGGTGGCGCAAGGCTGGGCTGGGCTGGGCTGGGGG
GGGATGCAGCTACCCCGGGTGGGACAGGAGGTGATTGTGGACTTTATCGATGGCAATCCGGACGCGCCCC
TGATTACCGGCCGGGTCTATAACGCCAACCAGACGCCCCCCTTCAAGTTGCCTGACAATAAGACCCAAAG
CGGCATTCAGACCCGCAGCACGCCCAATGGCAATGCGGAGCACTTCAGCCTGCTGCGCTTCGAGGACAAG
ATGGGCGCGGAAGAGGTGTTCATGCAGTCGGCGCGGGATTTTCGCCGTCTGGTGAAGCACGATGACGAGC
TTACGGTAGAGCATGACCGCCGGGTGACCATCAAGAATGACTGCTCTGAGACGGTCTCCGAGGGGAACTA
CCTGCAGAGTATTACCAAGGGAAAGCATACCCGGATGATCGAGGGCGATACCTTAACGGAGGTCAAGTCA
GGCAACAGCACGTTACAGGTAGACAGGGGGGATCACGCCACCAGAGTCTCGGCAGGCAGCCTTCATCTGG
AGGCCGGAACCTCGATAACCCTGAGCGTAGGCAGCAACCGTATCGTCATTGACAGCAGCGGCGTACTCAT
CGAGGGCATGGATATCACGGTGAAGGGTAAACAGTCCATTGATGCCTCCGGCCTGAGCGTAGCAATAAAG
GGAACCCAATCGGCCAGCCTGAGCAGTTCGGCAGAGGTGGAGGTCTCCTCCTCCGTGATGACCTCCATCA
AAGGCGGCATTGTCAAGATCAACTGA