SecReT6
Effector Protein ID: 251788066
-
SecReT6 ID351
T6SS typeA1
Gene symbol-
Locus tagDd1591_0420
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]483390..487817 [+]
ProductYD repeat protein
Effector typeProtein
Homologous effectorDda3937_01758
DescriptionRhsA
UniProt IDC6CI62
KEGG IDdze:Dd1591_0420
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 425..439
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 481..508
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 501..528
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 568..600
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 607..639
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 627..661
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 669..707
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 691..726
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 744..771
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 781..814
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 821..857
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 862..894
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 917..940
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 955..986
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 976..1006
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 1013..1039
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 1026..1056
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 1080..1109
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 1127..1155
RHS_repeat [PF05593], Evalue: 4.40E-51, Aligned region: 1152..1172
PAAR_motif [PF05488], Evalue: 6.70E-18, Aligned region: 9..22
PAAR_motif [PF05488], Evalue: 6.70E-18, Aligned region: 130..193
RHS [PF03527], Evalue: 0.0054, Aligned region: 454..460
RHS [PF03527], Evalue: 0.0054, Aligned region: 583..596
RHS [PF03527], Evalue: 0.0054, Aligned region: 649..661
RHS [PF03527], Evalue: 0.0054, Aligned region: 1070..1080
RHS [PF03527], Evalue: 0.0054, Aligned region: 1220..1238
RHS [PF03527], Evalue: 0.0054, Aligned region: 1372..1378
Protein Sequence: 1475 a.a.     [Download]
>gi|251788066|ref|YP_003002787.1| YD repeat protein [Dickeya zeae Ech1591]
MLNDILSRVARVGAMHAGNRPNPPADRPQPCQGKPPTSPGKTIKHKSFLGALAGAVAGALVAAAVFTAAA
AVAGAIAVAAIGTGGMGAALVVGVVKLAAGFGAVSLLGGLIDAVSSKVSAMVDSGSPSFGPVMAGSGNVF
VEKQPVARATKDTVACTRHNSPQLIAQGSESVFVNDAPAARIDDKTVCGATIKEGASTVFFGSGQGTYLE
IAEEFTALQRALLIAVEFLVPPSRGMFRGLGKLFTRGPMAVLKGMRAGALKTLEGLKSAVKCASEGFRNS
RGLSRVTEAVRGFLKDPVYIASGEVIESRTDIALGQTLPLVFERTYRSASVHTGLLGRGWHDSWSEVATV
TRDGLNTHVVITLAQGYDIDFTFHQDVQAVYCPHYPEFTLHRRGDGFSLWHRDQQTWRDFSVVQGERRLL
SAIHDSHDNRIELVRDPKGYLRQVRHSDGVTLLLVWRGEYLHQIQRIDGGQKTLLAEYRQDEQGRLVEAN
ATHAYHLYYEYDAAHRLTRWHDNDQTWARYEYDTQGRCVYTTCADGFLTARFDYLPDRVVMTDGLGQRSE
FGFNDLHLMSWEQSPLGHVTRYEYDEVGNLLREISPAGRVVEFGYLDDTGRVSTFTDASGHQWRYDYDDA
LRLCGVTDPLGREWRWVYDAEGNPERLTGPEASEVRFAWNRYGLLTQVSDAAGEVQARLQYDHRQRLLSA
TDAESRTQQMRYDMQDRVVQWQRADGARFRLGYRRASWALPEQLIRPDDKEEQRQYDRHNNLLSYVDGNG
ALWRQSFGPFDLLTARTDAEGHTWRYAYDKESQQLTTVIAPDGSRWQWWLDADGRVVRERDMTGTETHYG
YDEDGLCVSVRNGEGDTRHFLYDARGLLLRETAPDDTLHYRYDAVGRLTEVSSATAHVQLDYDLRDRVVR
EWHNGTLLTRQVDDNARTVTRTLTWDGDAGDTTGTLAPLTSLFHYTRTGELRQVQLPDGADLTLTYDAAG
RESHRRGGSGFVQQREYDVMGWLTREMSGAQHDGHLLAAQTREYRYDGAGNLTGVRHNRDAEGYRLDATG
RVQAVLSGGAGKPVDTTARFHYTRTGLPQEAGRLTEWQAGRLVQHDDTHYQYDRAGRLIRKQVVQPGYRP
QVWQYRWDSRNQLRVVDTPTGERWLYRYDPFGRRVGKRCDQKAEETRYQWDGDQIAEIRHYRHGQLVARR
HWVYNGWELVVQQRQHTGGDWETDFVTSSQNGTPQALFTPDGTLRWQAPTATLWGQRQAEKSESPDPGLA
FAGQLRDSESGLCYNRFRYYDPAGGCYVSPDPIGIAGGENNYGYVQNPMCWVDPFGLAGCSSYLNAWGGR
NAKAFKNFWNNSSHADFMKAWNNPAFKKNIKARLRGGGLTNSGGYHEWLPVSQGDKFKKMGFSFEEYMSL
TSPTNKVGFLDKFGNYGSHTSYTGGVTKASAQAHRDLINMAKLAQTKSGYLGAVQKWSGEHLPFGQFDLP
SGFWK
-
Nucleotide Sequence: 4428 bp     [Download]
>gi|251787652|ref|NC_012912.1|:483390-487817 Dickeya zeae Ech1591 chromosome, complete genome
ATGCTCAACGATATTCTGAGCCGGGTGGCCCGGGTAGGGGCCATGCATGCCGGAAACCGTCCCAACCCGC
CCGCCGACCGGCCGCAACCCTGTCAGGGTAAACCGCCAACGTCGCCGGGCAAGACCATCAAGCACAAGAG
CTTCCTGGGTGCACTGGCGGGTGCCGTGGCCGGGGCGCTGGTGGCGGCCGCCGTATTTACCGCCGCTGCG
GCCGTGGCGGGTGCTATCGCCGTTGCGGCGATTGGCACGGGTGGAATGGGGGCGGCGCTGGTGGTGGGGG
TGGTAAAACTGGCCGCCGGATTTGGTGCGGTCAGCCTGCTGGGTGGGCTGATAGACGCGGTGTCCAGCAA
GGTGTCGGCGATGGTGGACAGCGGCTCGCCATCGTTCGGACCGGTGATGGCGGGCTCGGGTAACGTGTTT
GTCGAAAAACAGCCGGTGGCCCGCGCCACGAAAGATACCGTCGCCTGCACCCGGCACAACAGCCCGCAAC
TGATTGCCCAGGGCAGCGAGTCGGTATTTGTGAACGACGCGCCAGCGGCCCGTATCGACGATAAAACCGT
GTGTGGTGCCACTATCAAGGAAGGGGCCTCGACGGTATTTTTCGGCTCCGGGCAGGGCACCTATCTGGAG
ATTGCCGAAGAGTTTACCGCGCTGCAACGCGCGCTGCTGATTGCGGTGGAGTTTCTGGTGCCGCCCAGCC
GCGGCATGTTCAGGGGGCTGGGGAAACTGTTCACCCGTGGGCCGATGGCGGTACTAAAAGGGATGCGCGC
CGGGGCGCTGAAAACGCTGGAAGGACTGAAAAGCGCCGTTAAATGTGCCAGTGAGGGGTTTCGCAACAGC
AGGGGACTGTCGCGTGTCACGGAAGCGGTGCGCGGTTTCCTCAAAGACCCGGTTTATATCGCCAGCGGCG
AGGTGATTGAATCCCGTACCGATATCGCGCTGGGCCAGACGCTGCCGCTGGTGTTCGAACGCACCTACCG
CTCTGCCTCGGTACACACCGGGCTGCTGGGCCGCGGCTGGCACGACAGTTGGAGCGAGGTGGCGACGGTA
ACGCGCGACGGCCTCAACACCCACGTGGTCATCACGCTGGCACAGGGCTACGACATCGATTTTACCTTCC
ATCAGGACGTACAGGCGGTGTACTGCCCACACTACCCTGAATTTACCCTGCACCGCCGGGGCGACGGCTT
CAGCCTGTGGCACCGCGACCAGCAGACCTGGCGCGACTTTAGCGTGGTGCAGGGCGAGCGCCGGTTGCTG
TCGGCCATTCACGATAGCCACGACAACCGCATTGAACTGGTGCGCGACCCGAAAGGCTACCTGCGCCAGG
TGCGCCACAGCGACGGCGTCACCCTGCTGCTGGTGTGGCGGGGCGAGTACCTGCACCAGATACAACGCAT
CGACGGCGGCCAGAAGACGTTGCTGGCCGAGTACCGCCAGGACGAACAGGGCCGACTGGTGGAAGCCAAC
GCCACCCACGCCTATCACCTCTACTACGAGTACGACGCCGCCCATCGGCTGACCCGCTGGCACGATAACG
ACCAGACCTGGGCGCGCTACGAATACGATACGCAGGGGCGCTGCGTCTACACCACCTGCGCCGACGGGTT
TCTGACCGCCCGCTTCGACTACCTGCCCGACCGGGTGGTGATGACCGACGGCCTCGGCCAGCGCAGCGAA
TTCGGCTTTAACGACCTGCACCTGATGAGCTGGGAACAATCCCCGCTCGGTCACGTCACCCGCTACGAGT
ACGACGAGGTCGGCAACCTGCTGCGGGAAATCTCGCCCGCCGGGCGGGTGGTCGAATTCGGCTATCTGGA
CGACACCGGGCGGGTCAGCACCTTTACCGACGCCAGCGGGCATCAGTGGCGGTACGACTACGACGACGCG
CTGCGGCTGTGCGGCGTCACCGACCCGCTGGGACGCGAGTGGCGCTGGGTGTATGACGCCGAGGGTAACC
CGGAACGGCTCACCGGCCCGGAAGCCAGCGAGGTACGATTCGCCTGGAACCGCTACGGCCTGCTGACCCA
GGTCAGCGACGCCGCCGGTGAGGTGCAGGCGCGGTTGCAGTACGACCACCGCCAGCGGCTGCTGAGCGCC
ACCGATGCCGAGAGCCGCACCCAGCAAATGCGTTACGACATGCAGGACCGGGTGGTACAGTGGCAACGGG
CGGATGGTGCCCGTTTCCGGCTCGGCTACCGCCGGGCCAGCTGGGCACTGCCGGAGCAACTGATACGCCC
GGATGACAAGGAAGAGCAGCGCCAGTACGACCGCCACAACAACCTGCTGAGCTACGTGGACGGCAACGGC
GCGCTGTGGCGTCAGAGCTTCGGCCCGTTCGACCTGCTGACCGCCCGCACCGACGCCGAAGGCCACACCT
GGCGCTACGCGTACGATAAAGAGAGCCAGCAACTGACAACGGTTATTGCCCCGGACGGCAGCCGCTGGCA
GTGGTGGCTGGACGCCGACGGGCGGGTCGTCCGCGAGCGTGACATGACCGGCACCGAGACCCACTACGGC
TACGACGAGGACGGCCTGTGCGTCAGCGTGCGCAACGGCGAAGGCGACACCCGCCACTTCCTCTACGACG
CCCGCGGGCTGCTGTTGCGTGAAACCGCGCCGGACGACACCCTGCACTACCGGTACGATGCGGTGGGCCG
CCTGACCGAGGTCTCGTCGGCCACCGCCCATGTGCAGCTGGACTACGACCTGCGCGACCGGGTGGTGCGC
GAATGGCACAACGGCACGCTGCTTACCCGGCAGGTTGATGACAACGCCCGCACCGTCACCCGCACCCTGA
CCTGGGACGGCGACGCCGGGGACACCACCGGCACCCTCGCGCCGCTCACCAGTCTGTTCCATTACACCCG
CACCGGCGAGCTGCGGCAGGTGCAGTTGCCGGACGGTGCCGACCTGACCCTGACCTATGACGCGGCGGGC
CGCGAGTCACACCGCCGCGGCGGCAGCGGCTTTGTCCAGCAGCGGGAATACGACGTGATGGGCTGGCTGA
CGCGGGAGATGAGCGGGGCACAGCACGACGGCCACCTGCTGGCGGCACAGACGCGGGAATACCGCTACGA
CGGTGCCGGTAACCTGACCGGGGTGCGTCACAACCGCGACGCCGAAGGTTATCGTCTGGACGCCACCGGC
CGGGTGCAGGCAGTGCTGAGCGGCGGTGCGGGCAAACCGGTGGACACCACCGCCCGCTTCCACTACACCC
GCACCGGTCTGCCGCAGGAGGCAGGGCGGCTTACCGAGTGGCAGGCGGGCAGACTGGTTCAGCACGATGA
CACCCATTACCAGTACGACAGGGCCGGACGGCTTATCCGTAAACAGGTGGTGCAGCCGGGCTACCGCCCG
CAGGTGTGGCAGTACCGCTGGGACAGCCGCAACCAGCTGCGGGTGGTGGATACCCCGACCGGCGAACGCT
GGCTGTACCGTTACGACCCGTTCGGTCGCCGGGTGGGCAAACGCTGCGACCAGAAAGCCGAAGAGACCCG
CTACCAGTGGGACGGCGACCAGATAGCGGAAATCCGCCACTACCGCCACGGCCAGCTCGTGGCCCGCCGT
CACTGGGTCTACAACGGCTGGGAGCTGGTGGTACAGCAGCGCCAGCACACCGGCGGCGACTGGGAAACGG
ATTTTGTGACCAGCAGCCAGAACGGTACTCCACAGGCGCTGTTCACACCGGACGGCACCCTGCGCTGGCA
GGCCCCGACAGCCACCCTGTGGGGCCAGCGTCAGGCAGAAAAATCGGAAAGTCCGGACCCCGGCCTGGCC
TTCGCCGGGCAGCTCCGTGACAGCGAAAGCGGGCTATGCTATAACCGCTTTCGGTACTACGACCCGGCCG
GTGGGTGTTATGTCTCGCCAGACCCGATAGGGATAGCGGGGGGTGAGAATAACTATGGCTACGTCCAGAA
TCCCATGTGCTGGGTTGATCCGTTTGGGTTGGCTGGATGTAGTTCATACCTTAATGCTTGGGGAGGGAGA
AATGCCAAAGCATTTAAGAATTTTTGGAATAACTCAAGTCATGCTGATTTCATGAAAGCTTGGAATAATC
CTGCTTTCAAAAAAAATATCAAAGCTAGACTACGAGGTGGCGGTTTAACTAACAGTGGTGGGTATCATGA
ATGGCTTCCTGTTTCACAGGGAGATAAATTTAAAAAAATGGGATTCTCTTTTGAGGAGTATATGTCTTTG
ACCTCACCAACCAATAAAGTTGGATTCTTAGACAAATTTGGGAATTACGGTTCTCACACCAGCTACACAG
GTGGTGTAACAAAGGCATCAGCTCAAGCACATAGAGATCTGATCAATATGGCCAAGTTGGCCCAAACAAA
ATCTGGTTATTTAGGGGCTGTCCAAAAATGGTCGGGGGAGCATCTACCATTTGGTCAGTTTGATTTGCCA
TCAGGATTTTGGAAATAA