SecReT6
Effector Protein ID: 251788785
-
SecReT6 ID351
T6SS typeA1
Gene symbol-
Locus tagDd1591_1160
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]1322501..1326772 [-]
ProductYD repeat protein
Effector typeProtein
Homologous effectorDda3937_01758
DescriptionRhsA
UniProt IDC6CPH2
KEGG IDdze:Dd1591_1160
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 410..424
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 466..493
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 486..513
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 553..585
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 592..627
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 612..647
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 633..669
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 654..692
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 676..711
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 730..756
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 766..799
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 806..842
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 847..879
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 867..896
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 903..923
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 962..991
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 998..1024
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 1011..1041
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 1065..1094
RHS_repeat [PF05593], Evalue: 4.10E-53, Aligned region: 1112..1140
PAAR_motif [PF05488], Evalue: 9.30E-18, Aligned region: 9..22
PAAR_motif [PF05488], Evalue: 9.30E-18, Aligned region: 113..178
WHH [PF14414], Evalue: 2.30E-16, Aligned region: 426..437
WHH [PF14414], Evalue: 2.30E-16, Aligned region: 771..781
WHH [PF14414], Evalue: 2.30E-16, Aligned region: 1366..1412
Colicin-DNase [PF12639], Evalue: 7.60E-07, Aligned region: 1351..1405
Protein Sequence: 1423 a.a.     [Download]
>gi|251788785|ref|YP_003003506.1| YD repeat protein [Dickeya zeae Ech1591]
MLNDILSRVARVGAMHAGNRPNPPADRPQPCQGKPPTSPGKTIKHKSFLGALAGAVAGALVAAAVAAAAV
FLVGVTGGLAVAAVGALAVFAAGDLISAVTNKVSAMVDSASPAFGPVASGSGNVFVEKQPVARATKDTVA
CTKHNSPQLIAQGSESVFVNDAPAARIDDKTVCGATIKEGASTVFFGSGQGTYLDIADEFSWWEKALLIA
VEFLVPPSRGMLKGLGKLFIRGPKAVLRGSRAGAKWIAGRLADKSSCASQAFKASSGLTRVKAAVKAFLK
DPVYIASGEVIESRTDIALGQTLPLVFERTYRSASGHVGLLGRGWHDSWSEVATVTRDGLNTHVVITLAQ
GYDIDFTFHQDVQAVYCPHYPEFTLHRRGEGFSLWHRDQQTWRDFSVVQGERWLLSAIHDSHDNRIELVR
DPKGYLRQVRHSDGVTLLLVWRGEFLHQIQRIDGGQKTLLAGYRQDEQGRLVEADATHAYHLYYEYDAAH
RLTRWHDNDQTWARYEYDAQGRCVYTTCADGFLTARFDYLPDRVVMTDGLGQRSEFGFNDLHLMSWEQSP
LGHVTRYEYDEVGNLLREISPAGRVVEFGYLDDTGRVSTFTDASGHQWQYAYDDEQRLCGVTDPLGREWG
WAYDAEGNPERLTGPDASEVRFTWNRYGLLTQVSDAAGEVQARLQYDHRQRLLSATDAESRTRQLRYDGQ
DRVVQWQRADGARFRLGYRRASWTLPEQLIRPDDKEEQRQYDRHNNLLSYVDGNGALWRQTFGPFDLLTA
RTDAEGRTWHYAYDKESQQLTTVIAPDGSRWQWWLDADGRVIRERDMTGTETHYGYDEDGLCISVRNGEG
DTRHFLYDARGLLLRETAPDDTLHYRYDAVGRLTEVSSATAHVQLDYDLRDRVVREWHNGTLLTRQYDDT
ARTVTRTLTWDGDAGDTTGTLAPLTSLFHYTRTGELRQVQLPDGADLTLTQDAAGRESHRRGGSGFVQQR
EYDVMGWLTREMSGAQHDGHLLAAQTREYRYDGAGNLTGVRHNRDAEGYRLDATGRVQAVLSGGAGKPVD
TLARFHYTRTGLPQEAGRLTEWQSGRLVQHDDTHYQYDRAGRLIRKQVVQPGYRPQVWQYRWDSRNQLRV
VDTPSGERWLYRYDPFGRRVGKRCDQKAEEIRYQWDGDQIAEIRHYRHGQLVARRHWVYNGWELVVQQRQ
HTGGDWETDFVTSSQNSTPQALFTPDGTLRWQAPKATLWGQRQAEKSESPDPGLAFAGQLRDSESGLCYN
RFRYYDPAGGCYVSPDPIGIAGGDNNYAYAPNPITWIDPLGLAGCSIQKLEEKGFTGVKSTKNGGLDYAN
SNALYSKEGVNPIRRIEYTGNYHKDFEQANMAVLGRKTTPKGYVWHHLDDYDPVTNTGTMQLVQQAAHKG
IPHVGGVSQYQNITGLKYIFKIW
-
Nucleotide Sequence: 4272 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1326772-1322501 Dickeya zeae Ech1591 chromosome, complete genome
ATGCTCAACGATATTCTGAGCCGGGTGGCCCGGGTGGGGGCCATGCATGCCGGAAACCGTCCCAACCCGC
CCGCCGACCGGCCGCAGCCCTGTCAGGGTAAACCGCCAACGTCGCCGGGCAAGACCATCAAGCACAAGAG
TTTCCTCGGCGCACTGGCCGGTGCCGTGGCCGGGGCGCTGGTGGCAGCGGCCGTCGCGGCGGCGGCAGTG
TTTCTGGTCGGTGTCACCGGCGGGCTGGCAGTGGCGGCCGTCGGGGCACTGGCGGTGTTTGCTGCCGGTG
ACCTGATTTCCGCCGTCACCAACAAGGTCTCGGCGATGGTGGACAGTGCGTCACCGGCCTTCGGGCCGGT
GGCGTCCGGCTCGGGTAACGTGTTTGTCGAAAAACAGCCGGTCGCCCGCGCCACGAAAGACACCGTCGCC
TGCACCAAGCACAACAGCCCGCAACTGATTGCCCAGGGCAGCGAGTCGGTATTTGTGAACGACGCGCCGG
CCGCCCGTATCGATGATAAAACCGTGTGTGGCGCCACTATCAAGGAAGGCGCCTCGACGGTCTTTTTCGG
CTCCGGGCAGGGCACCTATCTGGACATCGCCGACGAGTTCAGTTGGTGGGAAAAAGCGTTGCTGATTGCG
GTGGAGTTTCTGGTGCCACCCAGCCGGGGTATGTTGAAGGGACTGGGAAAGCTGTTTATCCGTGGTCCCA
AGGCAGTACTACGCGGATCCAGAGCAGGGGCAAAGTGGATTGCCGGTCGCCTCGCGGATAAATCATCTTG
TGCCAGTCAGGCTTTCAAAGCCAGCAGTGGGCTGACGCGCGTCAAGGCAGCAGTAAAGGCGTTCCTGAAA
GACCCGGTTTATATCGCCAGCGGCGAGGTGATTGAATCCCGTACCGATATCGCACTGGGCCAGACGCTGC
CGCTGGTGTTCGAACGCACCTACCGCTCCGCCTCCGGGCATGTCGGGCTGCTGGGCCGCGGCTGGCACGA
CAGCTGGAGCGAGGTGGCGACGGTAACGCGCGACGGCCTCAACACCCACGTGGTCATCACGCTGGCACAG
GGCTACGACATCGATTTTACCTTCCATCAGGACGTACAGGCGGTGTACTGCCCGCACTACCCTGAATTTA
CCCTGCACCGCCGGGGCGAGGGTTTCAGCCTGTGGCACCGCGACCAGCAGACCTGGCGCGACTTTAGCGT
GGTGCAGGGCGAGCGATGGTTGCTGTCGGCCATTCACGATAGCCACGACAACCGCATCGAGCTGGTGCGC
GACCCGAAAGGCTACCTGCGCCAGGTGCGCCACAGCGACGGCGTCACCCTGCTGCTGGTGTGGCGGGGCG
AATTCCTGCACCAGATACAACGTATCGATGGCGGCCAGAAGACGTTGCTGGCCGGGTACCGCCAGGACGA
ACAGGGCCGACTGGTGGAAGCGGACGCCACCCACGCCTATCACCTCTATTACGAGTACGACGCGGCCCAT
CGGCTGACCCGCTGGCACGATAACGACCAGACCTGGGCGCGCTACGAATACGACGCACAGGGGCGCTGCG
TCTACACCACCTGCGCCGACGGTTTTCTGACCGCCCGCTTCGACTACCTGCCCGACCGGGTGGTGATGAC
CGACGGCCTCGGCCAGCGCAGCGAATTCGGCTTTAACGACCTGCACCTGATGAGCTGGGAACAATCCCCG
CTCGGCCACGTCACCCGCTACGAGTACGACGAGGTTGGCAACCTGCTGCGGGAAATCTCGCCCGCCGGGC
GGGTGGTCGAATTCGGCTATCTGGACGATACCGGGCGGGTCAGCACCTTTACCGACGCCAGCGGCCACCA
GTGGCAGTACGCCTACGACGACGAGCAGCGGCTGTGCGGCGTCACCGACCCGCTGGGCCGCGAGTGGGGC
TGGGCGTATGACGCCGAGGGTAACCCGGAACGGCTGACCGGCCCGGATGCCAGCGAGGTCCGATTCACCT
GGAACCGCTATGGCCTGCTGACCCAGGTCAGCGACGCCGCCGGTGAGGTGCAGGCGCGGTTACAGTACGA
CCACCGTCAGCGGCTGCTGAGTGCCACCGACGCCGAGAGCCGCACCCGGCAGTTACGCTACGACGGGCAG
GACCGGGTGGTGCAGTGGCAACGGGCGGACGGTGCCCGTTTCCGGCTCGGCTACCGCCGGGCCAGCTGGA
CGCTGCCGGAGCAGCTGATACGCCCGGACGACAAGGAAGAGCAGCGCCAGTACGACCGCCACAACAACCT
GCTGAGCTACGTGGACGGCAACGGCGCATTGTGGCGTCAGACCTTCGGGCCGTTCGACCTGCTGACCGCA
CGCACCGACGCCGAAGGCCGCACCTGGCACTACGCGTACGATAAAGAGAGCCAGCAACTGACAACGGTTA
TCGCCCCGGACGGCAGCCGCTGGCAGTGGTGGCTGGATGCCGACGGGCGGGTCATCCGCGAGCGTGACAT
GACCGGCACCGAGACGCATTACGGCTACGACGAGGACGGCCTGTGCATCAGCGTGCGCAACGGCGAAGGC
GACACCCGCCACTTCCTCTACGACGCCCGCGGCCTGCTGTTGCGTGAAACCGCGCCGGACGACACCCTGC
ACTACCGGTACGATGCGGTGGGCCGCCTGACCGAGGTCTCGTCAGCCACCGCCCATGTGCAACTGGACTA
CGACCTGCGCGACCGGGTGGTGCGTGAATGGCACAACGGCACACTGCTCACCCGCCAGTACGACGACACG
GCCCGCACCGTCACCCGCACCCTGACCTGGGACGGCGACGCCGGGGACACCACCGGTACCCTCGCGCCGC
TCACCAGTCTGTTCCATTACACCCGCACCGGCGAGCTGCGGCAGGTGCAGTTGCCGGACGGTGCCGACCT
GACCCTGACCCAGGACGCAGCGGGCCGCGAGTCACACCGTCGCGGCGGCAGCGGCTTTGTGCAGCAGCGG
GAATACGACGTGATGGGCTGGCTGACGCGGGAGATGAGCGGCGCACAGCACGACGGCCACCTGCTGGCCG
CACAGACGCGGGAATACCGCTACGACGGTGCCGGTAACCTGACCGGGGTGCGTCACAACCGCGACGCCGA
AGGTTATCGTCTGGACGCCACCGGCCGGGTGCAGGCAGTGCTGAGCGGCGGTGCGGGCAAACCGGTGGAC
ACCCTCGCCCGCTTCCACTACACCCGCACCGGTCTGCCGCAGGAGGCAGGCCGCCTCACCGAGTGGCAGT
CTGGCCGACTGGTTCAGCACGATGACACCCATTACCAGTATGACAGGGCCGGACGGCTTATCCGTAAACA
GGTGGTGCAGCCGGGCTACCGCCCGCAGGTGTGGCAGTACCGCTGGGACAGCCGCAACCAGCTGCGGGTG
GTGGATACCCCGAGCGGCGAACGCTGGCTGTACCGTTACGACCCGTTTGGCCGCCGGGTGGGCAAACGCT
GCGACCAGAAAGCCGAAGAAATTCGCTACCAGTGGGACGGCGACCAGATAGCGGAAATCCGCCACTACCG
CCACGGCCAGCTCGTGGCCCGCCGCCACTGGGTCTACAACGGCTGGGAGCTGGTGGTACAGCAGCGCCAG
CACACCGGCGGCGACTGGGAAACGGATTTTGTGACCAGCAGCCAGAACAGTACCCCGCAGGCGCTGTTCA
CACCGGACGGCACCCTGCGCTGGCAGGCACCGAAAGCCACGCTGTGGGGCCAGCGCCAGGCAGAAAAATC
GGAAAGTCCGGACCCCGGTCTGGCCTTCGCCGGGCAGCTCCGTGACAGCGAAAGCGGGCTGTGCTATAAC
CGCTTTCGGTACTACGACCCGGCCGGTGGGTGTTATGTGTCGCCGGACCCGATAGGGATAGCGGGTGGGG
ATAATAACTACGCTTACGCGCCGAATCCGATTACCTGGATCGACCCGCTGGGGCTGGCTGGGTGCTCCAT
TCAGAAATTAGAAGAAAAAGGGTTTACTGGAGTTAAGTCAACTAAGAATGGTGGACTAGATTATGCCAAT
AGCAACGCTTTATATTCAAAAGAAGGTGTGAATCCAATACGGCGGATTGAATATACGGGTAATTATCACA
AAGATTTTGAGCAGGCTAACATGGCCGTTTTAGGACGAAAAACTACGCCTAAAGGCTATGTGTGGCACCA
TTTAGATGATTATGATCCGGTAACAAATACAGGCACTATGCAACTGGTTCAACAGGCTGCCCATAAAGGT
ATTCCGCATGTTGGCGGGGTAAGTCAATATCAAAATATTACGGGATTGAAATATATTTTCAAAATATGGT
GA