SecReT6
Effector Protein ID: 251788788
-
SecReT6 ID351
T6SS typeA1
Gene symbol-
Locus tagDd1591_1163
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]1329170..1329688 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDC6CF09
KEGG IDdze:Dd1591_0417, dze:Dd1591_1163, dze:Dd1591_1501, dze:Dd1591_2826, dze:Dd1591_2558
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.90E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|251788788|ref|YP_003003509.1| Hcp1 family type VI secretion system effector [Dickeya zeae Ech1591]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVQGHEDEMLVQEFKHIVTVPTDPQSGQPAGQRVHKPFKF
TVALNKAVPLLYNALASGEMLPTVTLKWYRTSVEGKQEHFFTTTLTDATIVDINNQMPHCQDPSKQDYTQ
LIEVSLAYRKVDWEHTVAGTSGSDDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1329688-1329170 Dickeya zeae Ech1591 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACGCAGGGCAACATCACCGCCGGTGCCTTCACCT
CCGACTCCGTCGGCAACATCTACGTGCAGGGTCACGAAGACGAGATGCTGGTGCAGGAATTCAAACACAT
CGTCACCGTCCCGACCGACCCGCAGTCCGGCCAGCCTGCCGGTCAGCGCGTGCACAAACCGTTCAAGTTC
ACCGTTGCGCTGAACAAAGCCGTCCCGCTGCTGTATAACGCGCTGGCCTCCGGCGAAATGCTGCCGACCG
TGACCCTGAAATGGTATCGCACCTCTGTCGAAGGCAAGCAGGAGCATTTCTTCACCACCACCCTGACCGA
TGCCACCATCGTCGACATCAACAACCAGATGCCGCACTGCCAGGACCCGTCCAAGCAGGACTACACCCAG
CTGATTGAAGTGTCACTGGCCTACCGCAAGGTGGACTGGGAGCACACCGTGGCCGGGACTTCCGGCTCTG
ACGACTGGCGCGCGCCGATCGAAGCGTAA