SecReT6
Effector Protein ID: 251789120
-
SecReT6 ID351
T6SS typeA1
Gene symbol-
Locus tagDd1591_1504
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]1720854..1725227 [+]
ProductYD repeat protein
Effector typeProtein
Homologous effectorDda3937_01758
DescriptionRhsA
UniProt IDC6CF12
KEGG IDdze:Dd1591_1504
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 425..439
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 481..508
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 501..528
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 568..600
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 607..642
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 627..662
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 648..684
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 669..707
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 691..726
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 745..771
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 781..814
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 821..857
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 862..894
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 882..911
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 918..937
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 977..1006
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 1020..1039
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 1026..1056
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 1047..1079
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 1080..1109
RHS_repeat [PF05593], Evalue: 4.00E-52, Aligned region: 1127..1155
PAAR_motif [PF05488], Evalue: 6.60E-18, Aligned region: 9..22
PAAR_motif [PF05488], Evalue: 6.60E-18, Aligned region: 130..193
RHS [PF03527], Evalue: 0.0031, Aligned region: 583..596
RHS [PF03527], Evalue: 0.0031, Aligned region: 649..661
RHS [PF03527], Evalue: 0.0031, Aligned region: 1070..1080
RHS [PF03527], Evalue: 0.0031, Aligned region: 1220..1238
Protein Sequence: 1457 a.a.     [Download]
>gi|251789120|ref|YP_003003841.1| YD repeat protein [Dickeya zeae Ech1591]
MLNDILSRVARVGAMHAGNRPNPPADRPQPCQGKPPTSPGKTIKHKSFLGALAGAVAGALVAAAVFTAAA
AVAGAIAVAAIGTGGMGAALVVGVVKLAAGFGAVSLLGGLIDAVSSKVSAMVDSGSPSFGPVMAGSGNVF
VEKQPVARATKDTVACTRHNSPQLIAQGSESVFVNDAPAARIDDKTVCGATIKEGASTVFFGSGQGTYLE
IAEEFTALQRALLIAVEFLVPPSRGMFKGLGKLFTRGPMWVLKGMRVGALKTLKGLKSAVKCASEGFRNN
KGLSRVTEAVRGFLKDPVYIASGEVIESRTDIALGQTLPLVFERTYRSASVHTGLLGRGWHDSWSEVATV
TRDGLNTHVVITLAQGYDIDFTFHQDVQAVYCPHYPEFTLHRRGDGFSLWHRDQQTWRDFSVVQGERRLL
SAIHDSHDNRIELVRDPKGYLRQVRHSDGVTLLLVWRGEFLHQIQRIDGGQKTLLAGYRQDEQGRLVEAD
ATHAYHLYYEYDAAHRLTRWHDNDQTWARYEYDAQGRCVYTTCADGFLTARFDYLPDRVVMTDGLGQRSE
FGFNDLHLMSWEQSPLGHVTRYEYDEVGNLLREISPAGRVVEFGYLDDTGRVSTFTDASGHQWQYAYDDE
QRLCGVTDPLGREWGWAYDAEGNPERLTGPDASEVRFTWNRYGLLTQVSDAAGEVQARLQYDHRQRLLSA
TDAESRTRQLRYDGQDRVVQWQRADGARFRLGYRRASWTLPEQLIRPDDKEEQRQYDRHNNLLSYVDGNG
ALWRQTFGPFDLLTARTDAEGRTWHYAYDKESQQLTTVIAPDGSRWQWWLDADGRVVRERDMTGTETHYG
YDEDGLCVSVRNGEGDTRHFLYDARGLLLRETAPDDTLHYRYDAVGRLTEVSSATAHVQLDYDLRDRVVR
EWHNGTLLTRQVDDAARTVTRTLTWDGDADDTTNTLAPLTSLFHYTRTGELRQVQLPDGADLTLTQDAAG
RESLRTGGSGFVQQREYDVMGWLTREMSGAQHDGHLQPAQTREYRYDGAGNLTGVRHNRDAEGYRLDATG
RVQAVLSGGAGKPVDTTARYHYTRSGLPQEAGRLTEWQAGRLVQHDDTHYQYDRAGRLIRKQVLQPGYRP
QVWQYRWDSRNQLRVVDTPTGERWLYRYDPFGRRVGKRCDQKAEETRYLWDGDQIAEIRHYRHGQLIQRR
HWVYNGWELVVQQRQHTGGDWETDFVTSSQNGVPQALFTPDGTLRWQAPTATLWGQRQAEKSESPDPGLA
FAGQLRDSESGLCYNRFRYYDPAGGCYVSPDPLSILGGEQNYAYVPNPVGWVDPLGLARCNGLPSTRKPG
GTGASYDSINGQGLYILHEGGKIKYVGRGDAPSRLDIHAQTPGKSHLEQLIIFDNNLTKAEAKFLEEKLI
GMHGGAKSMNSLTNLLNKIRSYSPSNPNAANYKVAGDNSLWGNEILKDALSIIRGNT
-
Nucleotide Sequence: 4374 bp     [Download]
>gi|251787652|ref|NC_012912.1|:1720854-1725227 Dickeya zeae Ech1591 chromosome, complete genome
ATGCTCAACGATATTCTGAGCCGGGTGGCCCGGGTAGGGGCCATGCATGCCGGAAACCGTCCCAACCCGC
CCGCCGACCGGCCGCAACCCTGTCAGGGTAAACCGCCAACGTCGCCGGGCAAGACCATCAAGCACAAGAG
CTTCCTGGGTGCACTGGCGGGTGCCGTGGCCGGGGCGCTGGTGGCGGCCGCCGTATTTACCGCCGCTGCG
GCCGTGGCGGGTGCTATCGCCGTTGCGGCGATTGGCACGGGTGGAATGGGGGCGGCGCTGGTGGTGGGGG
TGGTAAAACTGGCCGCCGGATTTGGTGCGGTCAGCCTGCTGGGTGGGCTGATAGACGCGGTGTCCAGCAA
GGTGTCGGCGATGGTGGACAGCGGCTCGCCATCGTTCGGACCGGTGATGGCGGGCTCGGGTAACGTGTTT
GTCGAAAAACAGCCGGTGGCCCGCGCCACGAAAGATACCGTCGCCTGCACCCGGCACAACAGCCCGCAAC
TGATTGCCCAGGGCAGCGAGTCGGTATTTGTGAACGACGCGCCAGCGGCCCGTATCGACGATAAAACCGT
GTGTGGTGCCACTATCAAGGAAGGGGCCTCGACGGTATTTTTCGGCTCCGGGCAGGGCACCTATCTGGAG
ATTGCCGAAGAGTTTACCGCGCTGCAACGCGCGCTGCTGATTGCGGTGGAGTTTCTGGTGCCACCCAGCC
GCGGCATGTTCAAAGGGCTGGGGAAACTGTTCACCCGTGGGCCGATGTGGGTTCTAAAAGGGATGCGTGT
CGGGGCGCTGAAAACGCTAAAAGGACTGAAAAGCGCCGTTAAATGTGCCAGTGAGGGGTTTCGCAACAAC
AAGGGATTGTCGCGTGTCACGGAAGCGGTGCGCGGTTTCCTCAAAGACCCGGTTTATATCGCCAGCGGCG
AGGTGATTGAATCCCGTACCGATATCGCGCTGGGCCAGACGCTGCCGCTGGTGTTCGAACGCACCTACCG
CTCTGCCTCGGTACACACCGGGCTGCTGGGCCGCGGCTGGCACGACAGTTGGAGCGAGGTGGCGACGGTA
ACGCGCGACGGCCTCAACACCCACGTGGTCATCACGCTGGCACAGGGCTACGACATCGATTTTACCTTCC
ATCAGGACGTACAGGCGGTGTACTGCCCACACTACCCTGAATTTACCCTGCACCGCCGGGGCGACGGCTT
CAGCCTGTGGCACCGCGACCAGCAGACCTGGCGCGACTTTAGCGTGGTGCAGGGCGAGCGCCGGTTGCTG
TCGGCCATTCACGATAGCCACGACAACCGCATCGAGCTGGTGCGCGACCCGAAAGGCTACCTGCGCCAGG
TGCGCCACAGCGACGGCGTCACCCTGCTGCTGGTGTGGCGGGGCGAATTCCTGCACCAGATACAACGTAT
CGATGGCGGCCAGAAGACGTTGCTGGCCGGGTACCGCCAGGACGAACAGGGCCGACTGGTGGAAGCGGAC
GCCACCCACGCCTATCACCTCTATTACGAGTACGACGCGGCCCATCGGCTGACCCGCTGGCACGATAACG
ACCAGACCTGGGCGCGCTACGAATACGACGCACAGGGGCGCTGCGTCTACACCACCTGCGCCGACGGTTT
TCTGACCGCCCGCTTCGACTACCTGCCCGACCGGGTGGTGATGACCGACGGCCTCGGCCAGCGCAGCGAA
TTCGGCTTTAACGACCTGCACCTGATGAGCTGGGAACAATCCCCGCTCGGCCACGTCACCCGCTACGAGT
ACGACGAGGTTGGCAACCTGCTGCGGGAAATCTCGCCCGCCGGGCGGGTGGTCGAATTCGGCTATCTGGA
CGATACCGGGCGGGTCAGCACCTTTACCGACGCCAGCGGCCACCAGTGGCAGTACGCCTACGACGACGAG
CAGCGGCTGTGCGGCGTCACCGACCCGCTGGGCCGCGAGTGGGGCTGGGCGTATGACGCCGAGGGTAACC
CGGAACGGCTGACCGGCCCGGATGCCAGCGAGGTCCGATTCACCTGGAACCGCTATGGCCTGCTGACCCA
GGTCAGCGACGCCGCCGGTGAGGTGCAGGCGCGGTTACAGTACGACCACCGTCAGCGGCTGCTGAGTGCC
ACCGACGCCGAGAGCCGCACCCGGCAGTTACGCTACGACGGGCAGGACCGGGTGGTGCAGTGGCAACGGG
CGGACGGTGCCCGTTTCCGGCTCGGCTACCGCCGGGCCAGCTGGACGCTGCCGGAGCAGCTGATACGCCC
GGATGACAAGGAAGAGCAGCGCCAGTACGACCGCCACAACAACCTGCTGAGCTACGTGGACGGCAACGGC
GCGCTGTGGCGTCAGACCTTCGGGCCGTTCGACCTGCTGACCGCGCGCACCGACGCCGAAGGCCGCACCT
GGCACTACGCGTACGATAAAGAGAGCCAGCAACTGACGACGGTTATTGCCCCGGACGGCAGCCGCTGGCA
GTGGTGGCTGGACGCCGACGGGCGGGTCGTCCGCGAGCGTGACATGACCGGCACCGAGACCCACTACGGC
TACGACGAGGACGGCCTGTGCGTCAGCGTGCGCAACGGCGAAGGCGACACCCGCCACTTCCTCTACGACG
CCCGCGGGCTGCTGTTGCGTGAAACCGCGCCGGACGACACCCTGCACTACCGGTACGATGCGGTGGGCCG
CCTGACCGAGGTCTCGTCGGCCACCGCCCATGTGCAGCTGGACTACGACCTGCGCGACCGGGTGGTGCGT
GAATGGCACAACGGCACGCTGCTCACCCGCCAGGTTGATGACGCGGCCCGCACCGTCACCCGCACCCTGA
CCTGGGACGGCGATGCGGACGACACGACAAACACCCTCGCGCCACTCACCAGTCTGTTCCATTACACCCG
CACCGGCGAGCTGCGGCAGGTGCAGTTGCCGGACGGTGCCGACCTGACCCTGACCCAGGACGCGGCAGGC
CGGGAGTCGCTCCGCACCGGCGGCAGCGGCTTTGTCCAGCAGCGGGAATACGACGTGATGGGCTGGCTGA
CGCGGGAGATGAGCGGCGCGCAACACGACGGCCACCTGCAACCAGCGCAGACGCGGGAATACCGCTACGA
CGGTGCCGGTAACCTGACCGGGGTGCGTCACAACCGCGACGCCGAAGGTTATCGTCTGGACGCCACCGGC
CGGGTGCAGGCAGTGCTGAGCGGCGGGGCGGGCAAACCGGTGGACACCACTGCCCGTTACCACTACACCC
GCAGCGGTCTGCCGCAGGAGGCAGGCCGCCTTACCGAGTGGCAGGCCGGCAGACTGGTGCAGCACGATGA
CACCCACTACCAGTACGACAGGGCCGGACGGCTTATCCGTAAACAGGTACTCCAGCCGGGCTACCGCCCG
CAGGTGTGGCAGTACCGCTGGGACAGTCGCAACCAGCTGCGGGTGGTGGATACCCCGACCGGCGAACGCT
GGCTGTACCGCTACGACCCGTTCGGCCGCCGGGTGGGCAAACGCTGCGACCAGAAAGCCGAAGAGACCCG
CTACCTGTGGGACGGCGACCAGATAGCGGAAATCCGCCACTACCGCCACGGCCAGCTGATACAGCGCCGC
CACTGGGTGTACAACGGCTGGGAGCTGGTGGTACAGCAGCGCCAGCACACCGGCGGCGACTGGGAAACGG
ATTTTGTGACCAGCAGCCAGAACGGCGTGCCGCAGGCGCTGTTCACACCGGACGGCACCCTGCGCTGGCA
GGCCCCGACAGCCACGCTGTGGGGCCAGCGGCAGGCAGAAAAATCGGAAAGTCCGGACCCCGGTCTGGCC
TTCGCCGGGCAGCTCCGTGACAGCGAAAGTGGGTTGTGCTATAACCGCTTTCGGTACTACGACCCGGCTG
GCGGGTGTTATGTCTCGCCAGACCCACTGAGCATCCTGGGTGGTGAGCAGAACTATGCGTATGTGCCGAA
TCCGGTTGGATGGGTTGATCCGCTGGGGTTAGCTCGCTGTAATGGGTTGCCCTCAACTCGTAAACCGGGT
GGTACTGGGGCGAGTTATGATTCTATAAATGGGCAGGGGTTGTATATTTTACATGAAGGAGGGAAAATAA
AATATGTAGGTCGCGGAGATGCACCTTCGAGATTGGATATTCATGCTCAAACCCCTGGTAAGTCACACCT
AGAGCAATTAATCATTTTTGATAACAATCTGACAAAAGCAGAGGCGAAGTTTTTAGAAGAAAAATTAATA
GGTATGCATGGTGGCGCAAAATCTATGAATTCATTGACTAACCTACTAAATAAAATTCGATCATATAGTC
CATCTAATCCTAATGCAGCAAACTATAAAGTTGCTGGTGATAATTCATTATGGGGAAATGAAATATTAAA
GGATGCGCTATCTATAATAAGGGGGAATACATGA