SecReT6
Effector Protein ID: 251790163
-
SecReT6 ID351
T6SS typeA1
Gene symbol-
Locus tagDd1591_2568
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]2925892..2928687 [+]
ProductYD repeat protein
Effector typeProtein
Homologous effectorDda3937_01758
DescriptionRhsA
UniProt IDC6CM18
KEGG IDdze:Dd1591_2568
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 7..34
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 74..106
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 113..148
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 133..168
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 175..213
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 197..232
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 251..277
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 287..320
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 327..363
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 368..400
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 388..417
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 461..492
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 501..513
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 522..545
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 532..562
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 572..585
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 586..615
RHS_repeat [PF05593], Evalue: 5.60E-54, Aligned region: 633..661
RHS [PF03527], Evalue: 1.60E-05, Aligned region: 89..102
RHS [PF03527], Evalue: 1.60E-05, Aligned region: 155..167
RHS [PF03527], Evalue: 1.60E-05, Aligned region: 576..586
RHS [PF03527], Evalue: 1.60E-05, Aligned region: 726..744
Protein Sequence: 931 a.a.     [Download]
>gi|251790163|ref|YP_003004884.1| YD repeat protein [Dickeya zeae Ech1591]
MLTLRAYDAAHRLTRWHDNDQTWARYEYDAQGRCVYTTCADGFLTARFDYHPDRVVMTDGLGQRSEFGFN
DLHLMSWETSPLGHVTRYDYDDYGNLLREISPAGRVVEFTYLDDTGRVSTFTDASGHQWQYDYDDALRLC
GVTDPLGREWSWVYDAEGNPERLTGPDASEVRFTWNRYGLLTQVSDAAGEVQARLQYDHRQRLLSATDAE
SRTRQLRYDGQDRVVQWQRADGARFRLGYRRASWTLPEQLIRPDDKEEQRQYDRHNNLLSYVDGNGALWR
QTFGPFDLLTARTDAEGRTWHYAYDRESQQLTTVIAPDGSRWQWWLDADGRVIRERDMTGTETHYGYDED
GLCISVRNGEGDTRHFLYDARGLLLRETAPDDTLHYRYDAVGRLTEVSSATAHVQLDYDLRDRVVREWHN
GTLLTRQYDDAARTVTRTLTWDGDAGDTTGTLAPLTSLFHYTRTGELRQVQLPDGADLTLTHDAAGRESH
RRGGSGFVQQREYDVMGWLTREQSGAQQDGRLLAAQTREYRYDGAGNLTGVRHNRDAEGYRLDATGRVQA
VLSGGAGKPVDTTARYHYTRTGLPQEAGRLTEWQSGRLVQHDDTHYQYDKAGRLIRKQVVQPGYRPQVWQ
YRWDSRNQLRVVDTPTGERWLYRYDPFGRRVGKRCDQKAEEIRYQWDGDQIAEIRHYHHGQLVARRHWVY
NGWELVVQQRQHTGGDWETDFVTSSQNGTPQALFTPDGTLRWLAPKATLWGQRQAEKSESPDPGLAFAGQ
LRDSESGLCYNRFRYYDPAGGCYVSPDPIGIAGGENLYAYVKNPVSWIDPLGLTGCSITRGSDLTPEIVQ
NALKGDPMQTVQGTVSLPAVQRYVDRLLKGDIAPPIKVDGNVIVEGNHRYVAGKIVGILPEQVPGTLSPS
NIPRVKPMSETVADLFDWGNH
-
Nucleotide Sequence: 2796 bp     [Download]
>gi|251787652|ref|NC_012912.1|:2925892-2928687 Dickeya zeae Ech1591 chromosome, complete genome
ATGCTGACACTGAGGGCGTACGACGCGGCCCACCGGCTGACCCGCTGGCACGATAACGACCAGACCTGGG
CGCGCTACGAATACGACGCACAGGGGCGCTGCGTCTACACCACCTGCGCCGACGGCTTTCTGACTGCCCG
CTTCGACTACCACCCCGACCGGGTGGTGATGACCGATGGCCTCGGCCAGCGCAGCGAATTCGGTTTTAAC
GATCTGCACCTGATGAGCTGGGAAACCTCCCCGCTCGGTCATGTCACCCGCTACGACTACGACGACTACG
GCAACCTGCTGCGGGAAATCTCGCCCGCCGGTCGGGTGGTCGAATTCACCTATCTGGACGATACCGGGCG
GGTCAGCACCTTTACCGACGCCAGCGGCCACCAGTGGCAGTACGACTACGACGACGCGCTGCGGCTGTGC
GGCGTCACCGACCCGCTGGGACGCGAGTGGAGCTGGGTGTATGACGCCGAGGGTAACCCAGAACGGCTCA
CCGGCCCGGACGCCAGCGAGGTACGATTCACCTGGAACCGCTACGGCCTGCTGACCCAGGTCAGCGACGC
CGCCGGTGAGGTACAGGCGCGGTTGCAGTACGACCACCGCCAGCGGCTGCTGAGCGCCACCGACGCCGAG
AGCCGCACCCGGCAGTTACGCTACGACGGGCAGGACCGGGTGGTGCAGTGGCAACGGGCGGACGGTGCCC
GTTTCCGGCTCGGCTACCGCCGGGCCAGCTGGACGCTGCCGGAGCAGCTGATACGCCCGGATGATAAGGA
AGAGCAGCGCCAGTACGACCGCCATAACAACCTGCTGAGCTACGTGGACGGCAACGGCGCGCTGTGGCGC
CAGACCTTCGGCCCGTTCGACCTGCTGACCGCGCGCACCGACGCCGAAGGCCGCACCTGGCACTACGCGT
ACGACAGGGAAAGCCAGCAACTGACAACGGTTATTGCCCCGGACGGCAGCCGCTGGCAGTGGTGGCTGGA
TGCCGACGGGCGGGTCATCCGCGAGCGTGACATGACCGGCACCGAGACGCATTACGGCTACGACGAGGAC
GGCCTGTGCATCAGCGTGCGCAACGGCGAAGGCGACACCCGCCACTTCCTCTACGACGCCCGCGGCCTGC
TGTTGCGTGAAACCGCGCCGGACGACACCCTGCACTACCGCTATGATGCGGTGGGCCGCCTGACCGAGGT
CTCGTCAGCCACCGCCCATGTGCAACTGGACTACGACCTGCGCGACCGGGTGGTGCGTGAATGGCACAAC
GGCACGCTGCTCACCCGCCAGTACGATGACGCGGCCCGCACCGTCACCCGCACCCTGACCTGGGACGGCG
ACGCCGGGGACACCACCGGCACCCTCGCGCCGCTCACCAGTCTGTTCCATTACACCCGCACCGGCGAGCT
GCGGCAGGTGCAGTTGCCGGACGGTGCCGACCTGACCCTGACCCATGACGCGGCGGGCCGCGAGTCACAC
CGTCGCGGCGGCAGCGGGTTTGTGCAGCAGCGGGAATACGACGTGATGGGCTGGCTGACGCGGGAGCAGA
GCGGCGCGCAGCAGGACGGCCGCCTGCTGGCGGCCCAGACGCGGGAATACCGCTACGACGGCGCCGGCAA
CCTGACCGGGGTGCGCCACAACCGCGACGCCGAAGGCTACCGGCTGGATGCCACCGGCCGGGTGCAGGCA
GTGCTGAGCGGCGGGGCGGGCAAACCGGTGGACACCACCGCCCGCTACCACTACACCCGTACCGGTCTGC
CGCAGGAGGCCGGCCGTCTCACCGAGTGGCAGTCTGGCAGACTGGTTCAGCACGATGACACCCATTACCA
GTACGACAAGGCCGGACGGCTTATCCGTAAACAGGTGGTGCAGCCGGGCTACCGCCCGCAGGTGTGGCAG
TACCGCTGGGACAGCCGCAACCAGCTGCGGGTGGTGGATACCCCGACCGGCGAACGCTGGCTGTACCGTT
ACGACCCGTTCGGCCGCCGGGTGGGCAAACGCTGCGACCAGAAAGCCGAAGAAATTCGCTACCAGTGGGA
CGGCGACCAGATAGCGGAAATCCGCCACTACCACCACGGCCAGCTCGTGGCCCGTCGTCACTGGGTGTAC
AACGGCTGGGAACTGGTGGTACAGCAGCGCCAGCACACCGGTGGCGACTGGGAAACGGATTTTGTGACCA
GCAGCCAGAACGGTACCCCACAGGCGCTGTTCACACCGGACGGCACCCTGCGCTGGCTGGCACCGAAAGC
CACGCTGTGGGGCCAGCGACAGGCAGAAAAATCGGAAAGTCCGGACCCCGGCCTGGCCTTCGCCGGGCAG
CTCCGTGACAGCGAAAGCGGGCTGTGCTATAACCGCTTTCGGTACTACGACCCGGCCGGTGGGTGTTATG
TCTCGCCAGACCCGATAGGGATAGCGGGGGGTGAAAACCTGTATGCGTATGTCAAAAACCCGGTAAGTTG
GATCGACCCTCTTGGTTTAACGGGATGTAGCATCACCCGCGGTTCTGATTTAACACCTGAGATCGTTCAG
AATGCTTTGAAAGGCGACCCCATGCAGACAGTGCAAGGAACAGTTTCACTCCCCGCAGTCCAACGCTATG
TTGATCGATTACTAAAAGGTGATATAGCTCCCCCCATAAAAGTAGATGGCAACGTAATCGTTGAAGGAAA
TCATCGTTATGTTGCAGGAAAGATAGTGGGCATACTTCCTGAACAAGTCCCGGGAACCCTTTCTCCGAGT
AACATACCAAGAGTTAAACCTATGTCTGAAACCGTAGCTGACCTTTTCGACTGGGGGAATCACTAA