SecReT6
Effector Protein ID: 251790406
-
SecReT6 ID351
T6SS typeA1
Gene symbol-
Locus tagDd1591_2825
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3212635..3214671 [-]
Producttype VI secretion system Vgr family protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDC6CNX3
KEGG IDdze:Dd1591_2825
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-70, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 7.00E-23, Aligned region: 367..459
Protein Sequence: 678 a.a.     [Download]
>gi|251790406|ref|YP_003005127.1| type VI secretion system Vgr family protein [Dickeya zeae Ech1591]
MANSTGLQFTVKIGALAETTFAVVDFELSEALNQPFALSLSLASSQADIDFGAVLDQPCELLVWYEGELQ
RRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQTQKPDEIITELLQEAGISDFAFALRHD
HAVREYCVQYRESDLAFINRLAAEEGLFYYHEFEAGKHRVVFADDAGALTKGPELFFNLATQGLTEGAYV
RRFRYAEAVSTAEVALKDYSFKTPAYGLLHKKTSNELAHQRESYQHFDYPGRFKQDPSGKAFTGYRLDAL
RAGAMTGAGESNAAELRPGSTFTLTEHPNPAFNLAWQVVAVAHSGQQPQALEEESGGEPTTISNSFEVVK
ATTTWRAALPYKPMVDGPQIATVVGPAGEEIYCDRFGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPIITGRTFHATNPSPYVLPEHKTRTTLRTDTHKGSGFNELRFEDEAT
REQIYLHAQKDMDAVINNIHRQSVGLDQHLSVANDQFQRVDRHSHRTIGQDDFEQIGQDHHQSVGRHFVQ
RITQSFKRFIGGGEITRIDGSRQTTLSGSEETLIGAHQRVLVNTDSYLKAADIVLEAGQSLTIKAPGGFI
KIDGAGVTISGTLVKINDGGSAGAGTAPVSIEPESPTRPTLPDAPDRR
-
Nucleotide Sequence: 2037 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3214671-3212635 Dickeya zeae Ech1591 chromosome, complete genome
GTGGCCAACAGTACAGGATTGCAGTTTACCGTCAAAATCGGCGCATTGGCGGAAACCACCTTCGCGGTGG
TGGATTTTGAACTCAGCGAGGCGCTGAACCAGCCGTTTGCGCTGTCGCTGAGTCTTGCCAGCAGTCAGGC
GGATATCGATTTCGGCGCGGTGCTGGACCAGCCGTGCGAGCTGCTGGTGTGGTACGAAGGCGAGCTGCAA
CGACGGGTCAGCGGTATCGTCAGCCGCTTTGCCCAGGGCGACACCGGCTTTCGCCGCACCCGCTATCAGG
CCGAGGTGCGCCCGGCGCTGTGGCGGCTGGGGCTGCGCACCAACGCCCGTATTTTCCAGACCCAAAAACC
GGATGAGATCATCACGGAGCTGTTGCAGGAAGCCGGTATCAGCGACTTTGCCTTTGCCCTGCGCCATGAC
CACGCGGTGCGCGAATACTGCGTGCAGTACCGCGAAAGCGACCTGGCGTTCATCAACCGGCTGGCCGCAG
AAGAAGGGTTGTTCTACTACCACGAATTCGAAGCCGGCAAGCACCGGGTGGTGTTTGCCGATGACGCCGG
TGCGCTGACCAAAGGCCCCGAGCTGTTTTTTAACCTGGCAACACAAGGGCTGACCGAAGGGGCGTATGTG
CGCCGTTTCCGCTACGCCGAAGCGGTCAGTACCGCCGAGGTGGCGCTGAAGGACTACAGCTTCAAAACCC
CGGCCTACGGGTTGTTGCACAAGAAAACCAGCAACGAGCTGGCGCACCAGCGCGAATCCTACCAGCACTT
CGACTACCCCGGCCGCTTCAAGCAGGACCCGAGCGGCAAGGCGTTTACCGGCTACCGGCTGGATGCGCTG
CGTGCCGGCGCGATGACCGGGGCGGGCGAATCCAACGCCGCCGAACTGCGCCCCGGCAGTACCTTTACCC
TGACCGAGCACCCGAACCCGGCGTTTAATCTGGCCTGGCAGGTGGTGGCGGTGGCCCACAGCGGCCAGCA
GCCGCAGGCGCTGGAAGAAGAAAGTGGTGGCGAGCCGACCACCATTAGCAACAGCTTCGAGGTGGTAAAA
GCCACCACCACCTGGCGTGCGGCGCTGCCGTACAAACCGATGGTGGACGGCCCGCAGATTGCCACCGTGG
TGGGCCCGGCGGGCGAAGAGATTTACTGTGATAGATTTGGCCGGGTGAAGCTGCAGTTCCCGTGGGACCG
CTACGGCGCCAGCGACGACCAGAGCTCCTGCTGGGTGCGGGTCAGTCAGGGCTGGGCCGGTGGTCAGTAC
GGGTTAATCGCCATTCCGCGTATCGGTCATGAAGTGGTGGTGAGCTTTCTGGAAGGCGACCCGGACCAGC
CGATTATCACCGGGCGGACGTTTCACGCCACCAACCCGTCGCCGTATGTCTTGCCGGAGCATAAAACCCG
CACCACCTTACGCACCGATACGCACAAAGGCAGCGGCTTCAACGAGCTGCGTTTTGAAGATGAAGCCACC
CGGGAACAGATCTACCTGCACGCGCAGAAAGACATGGATGCGGTGATTAACAACATTCATCGCCAGAGCG
TTGGGTTGGATCAACATCTGAGCGTGGCGAATGACCAGTTCCAGCGGGTGGACCGCCATAGCCATCGCAC
CATCGGGCAGGATGATTTCGAACAAATCGGACAGGATCATCACCAGTCGGTCGGGCGTCATTTTGTGCAA
CGCATCACCCAGTCATTCAAGCGTTTCATTGGCGGTGGCGAGATCACCCGTATTGACGGCAGCCGCCAGA
CCACGCTGTCCGGTTCGGAAGAAACACTGATTGGCGCCCATCAGCGCGTACTGGTCAATACCGACAGTTA
CCTCAAAGCCGCGGACATCGTGCTGGAAGCCGGACAATCGCTGACCATCAAAGCGCCCGGCGGGTTTATC
AAGATTGACGGCGCGGGTGTCACCATTTCCGGCACGCTGGTGAAAATCAACGACGGCGGCTCCGCCGGGG
CGGGCACTGCGCCGGTGTCTATCGAACCCGAATCCCCCACCAGACCGACGCTGCCCGATGCGCCGGACCG
GCGTTAA