SecReT6
Effector Protein ID: 253686459
-
SecReT6 ID353
T6SS typeA1
Gene symbol-
Locus tagPC1_0051
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]56584..60897 [-]
ProductYD repeat-containing protein
Effector typeProtein
Homologous effectorDda3937_01758
DescriptionRhsA
UniProt IDC6DGM6
KEGG IDpct:PC1_0051
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 424..439
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 481..489
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 501..528
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 572..600
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 607..642
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 627..663
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 669..698
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 691..727
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 756..792
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 781..814
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 825..857
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 862..895
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 883..910
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 949..976
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 988..997
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 1019..1055
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 1083..1102
RHS_repeat [PF05593], Evalue: 2.70E-51, Aligned region: 1120..1149
YwqJ-deaminase [PF14431], Evalue: 1.50E-16, Aligned region: 1330..1429
PAAR_motif [PF05488], Evalue: 5.40E-16, Aligned region: 9..21
PAAR_motif [PF05488], Evalue: 5.40E-16, Aligned region: 130..193
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 499..525
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 521..590
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 579..638
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 661..691
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 789..852
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 880..897
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 880..903
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 1011..1037
DUF4595 [PF15283], Evalue: 3.30E-07, Aligned region: 1087..1130
Protein Sequence: 1437 a.a.     [Download]
>gi|253686459|ref|YP_003015649.1| YD repeat-containing protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MLSDILNRVARVGAMHAGKGPTPPAERPQPGQGKAPTSPGKTIKHKSFLGALAGAIAGAVVAAVVFAAAA
AVAGAIAVAVVGTGGMGAALVVGAVKLAVGFGAVSLLGGLISSVSSKVSAMVDSGSPPFGPVSSGSGTVF
AEKQKISRAEVDTVACTKHNSPQLIAQGSETVYVNGSPAARIDDKTVCGATIKEGASTVFFGSGQQTCLK
ISDEFSWWEKALLIAVEFLVPPSRGMFKGLGKLFTRGPTAVLKGIRMGALRTAVGLRKAVRCASKGFKNN
KGLARIKEATRGFLKDPVYIPSGNVIEMRQDIELGQTLPLLFERTYRSSSTHTGLLGRGWYDTWSETAQV
SRDGLNTHVVITLAQGYDIDFTFHQDVQSVFCPLYPAFTLYRRAKGFSLWDRDSLTWREFDVPQGDRLLL
SSIHDPHDNRITLIRDPKGYLRKIRHSDDIELLLVWRGESLHQIQRIDTGQKTLLAEYRQDEQGRLIEAD
AAHAYHLFYDYDSENRLTRWHDNDQTWARYEYDYQGRCVYTTCADGYLTAHFEYLDDRVVMTDGLGQRSE
FGFNALSLMSWEKSPLGRITRYDYDDHGNLLREISPAGRVVEFRYLDDSGLVSAFTDGSGHTWAYDYDEA
QRLCGITDPLGRIWQWAFDETGNPEKLTGPDTREVRFTWNRHGLLTQVSDQAGEVQARLRYDHRQRLLSA
SDALGRTQQLRYDQQDRVVQWQRPDGAQYRLGYRRASWKLPEQLVRPDEKEEKRQYDKHNNLLSYVDGNG
ALWRQSYGPFDLLTSRTDAQERTWRYEYDKESQQLVAVIAPDGSRWQWWLDADARVIRERDMAGTDTHYT
YDEDGHCIAIRNGEGETRHFLYDGRGLLIKETAPDDTQYYRYDAAGRLTEVTSTTSHVQLEYDLRDRVVR
EWLNGTLLTRQFDDTARTVTRTLVWENESDNALVSAFSYSAAGELQQVQLPDGAELTLAHDAAGRESSRS
GGAFVQHREYDVMGWLAREMSGQQQDGRLHATQTKEYLYDGAGNLAGVRHNRETRGYRLDATGRVLSVLS
GGAGRTVDTDEAYRYTRNGLPQETSRLTEWQAGRLTQHDDTHYQYDKAGRLIRKQVVQPGYRPQVWHYRW
DSRNQLRVVDTPTGERWFYRYDPFGRRTGKRCEQTQDDIRYLWDGDQIAEVRHYRNGKQIARRHWVHNGW
ELLVQQRQNTDGRWETDFVTSSQNGEPQALYKPDGTLRWQAPKSTLWGQRPGSTEDSADPGLAFAGQYRD
SESGLCYNRFRYYDPNGGCYVSPDPIGVLGGESNYAYVPNPNTWVDPFGLAGCSKELAQRKAQELRDSAT
SNTQRSKLPRATSAVVDKATGKVYYGFSGRPLPSTIHPHLAERMPSPSLERWPVQNCAEFKGVNQALLDG
ARLENLEVHTVKTISGEAFPMCSNCQTTIFGTIVTSG
-
Nucleotide Sequence: 4314 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c60897-56584 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGCTGAGTGATATTCTGAACCGCGTTGCCCGCGTCGGTGCTATGCACGCAGGCAAAGGCCCGACGCCGC
CTGCCGAACGTCCTCAACCGGGCCAGGGAAAAGCGCCGACATCACCGGGCAAAACCATCAAGCACAAAAG
CTTTCTCGGCGCGCTGGCCGGCGCTATCGCTGGGGCGGTCGTTGCCGCGGTGGTTTTTGCCGCCGCAGCG
GCTGTCGCAGGAGCGATTGCCGTCGCCGTTGTCGGGACGGGCGGCATGGGTGCGGCGCTGGTTGTCGGGG
CAGTTAAACTGGCGGTGGGATTTGGTGCAGTCAGCCTATTGGGAGGGCTAATTAGCAGCGTCTCCAGCAA
GGTTTCCGCCATGGTAGACAGCGGATCCCCGCCGTTTGGGCCGGTTTCTTCAGGCTCAGGAACGGTGTTT
GCGGAGAAGCAGAAGATTTCCCGCGCCGAGGTTGACACGGTCGCCTGTACCAAACACAACTCTCCTCAAT
TGATTGCGCAAGGCAGTGAGACCGTTTACGTCAATGGCTCTCCGGCTGCGCGTATCGACGATAAAACCGT
CTGTGGTGCCACTATCAAGGAAGGAGCATCAACCGTCTTTTTTGGTTCTGGACAGCAAACCTGCCTGAAG
ATTAGTGACGAATTCAGTTGGTGGGAAAAAGCGCTACTGATCGCGGTGGAGTTTCTGGTGCCGCCCAGCC
GGGGCATGTTCAAAGGGCTAGGCAAGCTGTTTACCCGTGGCCCTACTGCCGTGCTCAAAGGCATTCGGAT
GGGGGCGCTAAGAACAGCGGTAGGGCTACGAAAAGCGGTTCGCTGTGCCAGCAAAGGCTTTAAAAATAAC
AAAGGGTTAGCACGCATTAAGGAAGCCACTCGGGGCTTTCTGAAAGATCCGGTCTACATTCCCAGCGGGA
ATGTCATCGAAATGCGTCAGGATATTGAACTAGGGCAAACACTCCCCCTACTTTTTGAGCGCACGTATCG
ATCCTCTTCCACCCATACCGGGTTGCTGGGGCGCGGCTGGTATGACACTTGGAGCGAAACAGCGCAGGTC
AGCCGTGATGGCCTCAATACCCACGTTGTCATCACGCTGGCGCAGGGATATGACATCGATTTTACGTTCC
ATCAGGATGTGCAGTCGGTATTTTGTCCGCTCTATCCGGCTTTTACCCTGTATCGGCGGGCAAAGGGCTT
TAGCCTGTGGGATCGCGACAGTCTCACCTGGCGTGAATTCGATGTGCCTCAGGGCGATCGGCTACTTCTG
TCTTCGATACATGACCCGCATGACAACCGCATTACCCTGATCCGCGATCCAAAAGGCTATCTGCGCAAGA
TCCGCCACAGCGACGATATCGAGCTACTGTTGGTGTGGCGAGGGGAATCTCTGCACCAGATACAGCGTAT
TGATACTGGGCAGAAAACCCTGCTGGCTGAATACCGACAGGACGAACAGGGTCGCCTGATCGAAGCCGAT
GCCGCCCATGCCTATCACCTGTTTTACGACTACGACAGCGAAAACCGACTCACCCGCTGGCATGACAACG
ACCAGACCTGGGCGCGTTACGAATATGACTATCAAGGCCGCTGCGTCTATACCACCTGTGCCGACGGCTA
CTTGACGGCGCATTTTGAGTATCTCGACGATCGCGTGGTGATGACCGACGGACTAGGTCAGCGCAGCGAA
TTTGGTTTTAACGCGCTGTCGCTAATGAGTTGGGAGAAATCCCCGTTAGGGCGCATCACCCGCTACGACT
ACGACGACCACGGCAACTTGCTACGTGAGATTTCCCCAGCTGGCCGGGTGGTTGAGTTCAGGTATCTGGA
CGATAGCGGTCTGGTCAGCGCCTTCACTGACGGCAGCGGCCATACCTGGGCCTATGACTACGACGAGGCG
CAGCGGTTATGTGGCATCACCGATCCGCTGGGGCGCATCTGGCAATGGGCGTTCGATGAGACAGGCAACC
CGGAGAAACTCACGGGACCAGATACCCGTGAAGTCCGATTTACCTGGAACCGCCATGGCCTGCTGACGCA
GGTAAGCGATCAGGCCGGCGAGGTTCAGGCGCGACTGCGTTACGATCATCGTCAACGATTGCTGAGCGCC
AGCGATGCGCTGGGGCGCACCCAGCAGTTGCGCTATGACCAGCAGGACAGAGTGGTGCAGTGGCAGCGGC
CGGACGGCGCACAATACAGGCTAGGCTATCGTCGTGCGAGCTGGAAGCTACCGGAGCAACTCGTCCGTCC
TGATGAGAAAGAAGAAAAACGCCAGTACGACAAGCATAACAACCTGCTGAGCTATGTGGACGGCAACGGC
GCACTATGGCGACAAAGCTACGGTCCCTTTGACCTGCTCACCTCACGCACGGATGCACAGGAGCGTACCT
GGCGTTACGAGTATGACAAAGAGAGCCAGCAGCTGGTCGCCGTTATCGCCCCAGACGGCAGCCGCTGGCA
ATGGTGGCTGGATGCCGATGCACGAGTTATCCGCGAGCGGGATATGGCAGGGACCGACACCCACTACACC
TACGACGAAGACGGCCACTGCATCGCCATCCGTAATGGCGAAGGCGAAACTCGTCACTTTCTGTATGACG
GACGTGGGTTGCTCATTAAAGAAACTGCGCCGGACGATACCCAGTATTACCGCTATGACGCCGCAGGCAG
GCTGACCGAGGTCACCTCTACCACCAGTCACGTCCAGTTGGAATATGACCTCCGTGACCGGGTGGTGCGG
GAGTGGCTGAACGGCACCTTGCTCACCCGACAGTTTGACGATACCGCACGCACTGTGACGCGGACACTGG
TCTGGGAAAACGAGAGCGACAACGCGCTGGTCAGCGCCTTCAGCTACAGCGCGGCAGGTGAACTGCAACA
GGTGCAGTTGCCGGACGGTGCGGAGCTCACCCTTGCCCATGATGCCGCCGGACGGGAATCGTCGCGTTCA
GGCGGGGCGTTCGTCCAACACCGCGAATATGACGTGATGGGCTGGTTGGCGCGCGAGATGAGCGGTCAGC
AGCAGGACGGTCGACTCCATGCCACACAGACAAAGGAATACCTGTACGACGGTGCGGGCAATCTGGCTGG
CGTTCGCCACAATCGTGAAACCCGGGGCTACCGTCTGGATGCCACCGGGCGGGTGCTGTCCGTCCTGAGC
GGTGGCGCAGGACGGACGGTCGATACTGACGAAGCCTACCGCTATACACGCAACGGTCTGCCGCAGGAGA
CTTCCCGACTCACCGAATGGCAGGCGGGTAGGCTGACTCAGCACGACGATACCCATTACCAGTACGACAA
AGCCGGGCGACTCATCCGTAAACAGGTGGTTCAGCCGGGCTACCGCCCACAGGTCTGGCACTATCGCTGG
GACAGCCGTAACCAGCTCCGGGTTGTCGACACCCCGACGGGCGAACGCTGGTTCTACCGCTATGACCCGT
TCGGACGGCGCACCGGCAAACGCTGTGAGCAGACACAGGACGATATCCGCTACCTGTGGGACGGCGACCA
AATCGCCGAGGTACGGCATTATCGCAACGGTAAACAGATTGCCCGTCGCCACTGGGTACACAACGGCTGG
GAGCTGCTGGTTCAGCAACGGCAGAATACTGACGGACGCTGGGAAACCGATTTTGTCACCAGCAGCCAGA
ACGGTGAACCACAGGCCCTGTACAAACCCGACGGCACCCTGCGCTGGCAGGCACCGAAAAGCACCCTCTG
GGGCCAGCGACCAGGCTCCACGGAAGACTCTGCCGACCCGGGACTTGCCTTTGCCGGACAGTACCGTGAC
AGCGAAAGCGGGCTATGTTATAACCGTTTTCGGTACTACGATCCGAATGGTGGATGCTACGTCTCGCCTG
ACCCGATAGGGGTGCTGGGGGGAGAAAGTAATTATGCTTATGTGCCGAATCCCAATACATGGGTTGATCC
GTTTGGGTTGGCTGGGTGTTCTAAAGAACTAGCTCAAAGAAAAGCACAAGAGCTTCGTGATAGTGCCACA
TCAAATACTCAACGAAGTAAGTTACCCAGAGCAACGTCTGCGGTAGTCGATAAGGCCACAGGTAAAGTTT
ATTATGGTTTCAGTGGGCGACCTCTTCCTAGTACTATTCACCCTCATTTAGCAGAAAGAATGCCTAGTCC
TAGCTTAGAAAGATGGCCGGTTCAAAACTGTGCAGAATTCAAAGGTGTCAATCAGGCTTTGCTGGATGGA
GCTAGGTTAGAAAACCTGGAGGTTCATACAGTGAAGACTATATCAGGTGAGGCATTTCCAATGTGTTCAA
ATTGCCAAACTACCATATTTGGTACGATAGTTACGAGTGGATAG