SecReT6
Effector Protein ID: 253686461
-
SecReT6 ID353
T6SS typeA1
Gene symbol-
Locus tagPC1_0053
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]61325..63178 [-]
Producttype VI secretion system Vgr family protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDC6DGM8
KEGG IDpct:PC1_0053
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-66, Aligned region: 30..328
Phage_GPD [PF05954], Evalue: 7.20E-66, Aligned region: 531..548
Phage_base_V [PF04717], Evalue: 1.20E-22, Aligned region: 367..459
Protein Sequence: 617 a.a.     [Download]
>gi|253686461|ref|YP_003015651.1| type VI secretion system Vgr family protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQPFALSLNLASPLPGIDFGAVLDQPCELLVWYEGELQ
RRVSGIVSAFAQGDTGFRRTRYQAEVRPTLWRLGLRTNARIFQAQKPEAIIGALLEEAGITDYAFALRNE
HAVREYCVQYRESDLAFIARLAAEEGLFFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGAYV
RRFRYAEAVSTAEVALKDYSFKTPAYGLLHQKISGELEHQRESYQHFDYPGRFKQDPSGKAFTGYRLDAL
RAGAMTGSGESNAAELMPGSSFTLTEHPNLALNIGWQLVAITHSGQQPQALEEESGGEPTTYSNSFEVVK
ASTTWRADLPYKPMVDGPQIATVVGPAGEEIYCDQYGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTTLRTTTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRSTSVNVDHNENIGRDQTVVVQQNQTVSVIADQVTEIQGEQTVVVKKNRST
VVEDNETLRVTNNIFIHAEDGSIQIGTGAGYISIKHSGDIEIVGNNLTLNGTRIDLN
-
Nucleotide Sequence: 1854 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c63178-61325 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGGCAAACAGTACAGGATTACAGTTCACCGTTAAGGTCGGCGCATTGCCTGCGTCGACCTTTGCCGTGG
TGGATTTTCAGCTCAGCGAGGCGCTCAACCAGCCGTTTGCCCTGTCGCTGAATCTGGCCAGCCCCTTACC
GGGGATCGATTTTGGTGCGGTTCTCGACCAGCCCTGCGAACTCCTGGTGTGGTACGAAGGTGAACTCCAA
AGACGAGTGAGCGGTATTGTCAGCGCGTTTGCGCAGGGCGATACCGGCTTTCGCCGCACACGCTATCAGG
CAGAAGTCCGTCCGACTCTGTGGCGTTTGGGGCTACGTACCAATGCTCGTATATTTCAGGCGCAGAAGCC
TGAGGCAATTATCGGCGCCCTGCTGGAAGAAGCGGGCATCACCGACTACGCCTTTGCGCTGCGCAACGAG
CACGCAGTGCGGGAATATTGCGTGCAGTACCGCGAAAGCGATTTGGCCTTTATTGCCCGACTGGCTGCCG
AAGAAGGCCTGTTCTTCTTCCATGAGTTTGAGGAAGGCAAACACCGCGTCGTCTTTGCCGACGATGCAGG
CGCGTTGGCAAAAGGCCCTGAGCTGTTTTTCAACCTGGCGACACAGGGGCTGAGTGAAGGCGCATACGTG
CGTCGTTTCCGCTATGCCGAGGCGGTGAGCACAGCAGAAGTCGCACTCAAAGACTACAGCTTCAAAACCC
CAGCCTATGGCCTGTTGCACCAGAAAATCAGCGGAGAACTGGAACACCAGCGCGAAAGTTACCAACACTT
CGACTACCCCGGTCGTTTTAAACAAGATCCGAGCGGTAAAGCCTTTACCGGCTATCGGCTGGATGCACTG
CGAGCAGGGGCGATGACCGGCTCGGGCGAATCGAATGCCGCTGAACTGATGCCGGGCAGCAGTTTCACCT
TAACCGAACACCCCAATCTGGCACTCAATATCGGCTGGCAGTTGGTCGCCATCACCCACAGCGGGCAGCA
GCCGCAGGCGCTGGAAGAGGAAAGCGGCGGCGAACCGACCACCTACAGCAACAGCTTTGAAGTTGTGAAA
GCTAGCACGACCTGGCGCGCCGACCTGCCCTACAAACCAATGGTAGACGGCCCGCAGATCGCCACCGTCG
TCGGCCCGGCGGGTGAAGAAATTTACTGCGACCAGTACGGCAGGGTGAAACTGCAATTCCCGTGGGACCG
CTACGGCGCAAGCGATGACCAGAGCTCCTGCTGGGTACGCGTCAGCCAGGGTTGGGCAGGCGGCCAATAT
GGCCTGATCGCTATCCCGCGCATCGGCCATGAGGTCATCGTCAGCTTCCTCGAAGGCGACCCGGATCAGC
CCATCGTGACGGGCAGAACCTTCCACGCCACCAATCCCTCACCCTACCCGCTACCCGCCAACAAAACGCG
CACGACACTGCGCACCACGACCCATAAAGGCGCCGGGTTCAACGAACTGCGCTTTGAGGATCAGGCTGGT
CAGGAAGAAGTGTTTATCCATGCCCAGAAGGACATGAACACCGTGGTGCTGAATAACCGCAGTACATCGG
TGAATGTGGATCACAACGAAAACATTGGCCGCGATCAGACTGTCGTCGTGCAGCAAAACCAGACGGTTTC
TGTTATTGCCGATCAGGTTACCGAGATCCAAGGGGAGCAGACGGTGGTGGTGAAGAAAAACCGAAGCACC
GTCGTGGAAGACAATGAAACGCTGAGAGTGACAAACAACATCTTTATCCACGCCGAAGATGGCAGCATTC
AGATTGGTACGGGTGCGGGCTATATCTCAATCAAGCACAGCGGGGATATTGAGATCGTCGGGAATAACCT
GACGCTGAACGGCACCCGTATCGATTTGAATTAA