SecReT6
Effector Protein ID: 253686462
-
SecReT6 ID353
T6SS typeA1
Gene symbol-
Locus tagPC1_0054
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]63269..63787 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDC6DGM9
KEGG IDpct:PC1_0054
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.00E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|253686462|ref|YP_003015652.1| Hcp1 family type VI secretion system effector [Pectobacterium carotovorum subsp. carotovorum PC1]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDSTIVDINCQMPHCQDPSKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c63787-63269 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACGCAGGGCAACATCACCGCTGGTGCTTTCACGT
CTGATTCTGTCGGCAACATCTATGTGGAAGGCCACGAAGACGAAATGCTGGTACAAGAATTCAAACACAT
CGTCACCGTACCAACCGACCCGCAGTCTGGTCAGCCATCCGGCCAGCGCGTACACAAGCCGTTCAAATTC
ACCGTTGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCCCTGGCGTCCGGTGAAATGCTGCCGACAG
TGACCCTGAAATGGTACCGCACATCGGTTGAAGGCAAGCAGGAGCACTTCTTCTCTACCGTGCTGACCGA
TTCCACCATCGTTGACATCAACTGCCAGATGCCACACTGCCAGGACCCGTCAAAACTGGATTACACCCAA
CTGATTGAAGTGTCACTGGCCTACCGCAAAATTGACTGGGAACACACCGTTGCCGGTACCTCCGGTTCTG
ATGACTGGCGTGCGCCGATCGAAGCGTAA