SecReT6
Effector Protein ID: 253686843
-
SecReT6 ID353
T6SS typeA1
Gene symbol-
Locus tagPC1_0441
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]503878..504357 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorECA0456
DescriptionHcp protein
UniProt IDC6DJT4
KEGG IDpct:PC1_0441
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-30, Aligned region: 6..144
Protein Sequence: 159 a.a.     [Download]
>gi|253686843|ref|YP_003016033.1| Hcp1 family type VI secretion system effector [Pectobacterium carotovorum subsp. carotovorum PC1]
MANSIFMKITGKIQGLISEGCLSIDSVGNKHISGHEDEIFVYATNYDLSRDRHVNHHPFSVTKVVDKSTP
LLLTSIANNELLECELRYYRTSASGTQENYMTITLRDASIVNLSNQNPNSLTHNDMQPFETLSLRYESIT
CQHNIAGTSGYSILTENMY
-
Nucleotide Sequence: 480 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c504357-503878 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGGCTAATTCTATTTTTATGAAGATAACGGGAAAAATTCAGGGATTGATCTCTGAAGGATGTTTAAGTA
TCGACTCGGTAGGAAATAAACATATCTCTGGTCACGAAGATGAAATTTTTGTTTATGCGACAAACTACGA
CCTATCAAGAGATCGACACGTTAACCATCACCCCTTTTCCGTGACTAAAGTCGTTGATAAATCGACACCT
CTTCTACTCACCAGCATCGCCAATAATGAGCTATTGGAGTGCGAGTTAAGGTATTACCGCACGTCTGCCA
GCGGAACCCAAGAGAACTATATGACAATAACATTGAGAGATGCGTCTATTGTTAACCTCTCAAATCAAAA
CCCCAATTCATTGACCCATAACGATATGCAGCCATTTGAAACCCTCAGCCTGCGTTATGAGAGTATTACC
TGCCAGCACAATATCGCAGGTACATCGGGATATAGCATATTAACTGAAAATATGTACTGA