SecReT6
Effector Protein ID: 253688573
-
SecReT6 ID353
T6SS typeA1
Gene symbol-
Locus tagPC1_2188
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]2518230..2520200 [-]
Producttype VI secretion system Vgr family protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDC6DI54
KEGG IDpct:PC1_2188
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-71, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.90E-22, Aligned region: 367..459
Phage_base_V [PF04717], Evalue: 1.90E-22, Aligned region: 586..611
Gp5_C [PF06715], Evalue: 0.00031, Aligned region: 506..523
Gp5_C [PF06715], Evalue: 0.00031, Aligned region: 524..544
Gp5_C [PF06715], Evalue: 0.00031, Aligned region: 561..570
Protein Sequence: 656 a.a.     [Download]
>gi|253688573|ref|YP_003017763.1| type VI secretion system Vgr family protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MANSTGLQFTVKVGALAAGTFAVVDFRLDEGLNRPFSLSLSLASAQPDVDFGAVLDQPCELMIWYEGELK
RRVSGIVSGFTQGDTGFRRTRYQIDVRPALWRLGLRTNARIFQAQTPDAIISMLLEEAGITDYAFALRNE
HAVREYCVQYRESDLAFVTRLAAEEGMYFFHEYEEGKHRVVFADDAGALTKGPELFFNLATQGLSEGEYI
RRFHYAERVSTAEVELKDYSFKTPAYGLSHKKMSGELEHQRESYQHYDYPGRYKQDPSGKAFSGYRLDAL
RSGAVTGEGESNCAGLMPGSTFTLTEHPNTTLNAVWQTVSVTHVGQQPQALEEESGGEPTTMSNSFAVVK
GTTTWRTAMPYKPMVDGPQIATVVGPAGEEIYCDPYGRVKLQFPWDRYGASNDQSSCWVRVSQGWAGGQY
GMIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHVTNPSPYPLPANKTRTTLRSKTHKGKGFNELSFEDATD
NEEIFLHAQKNMAVRVLNSKDERVDYNRTTSIGHDEELVVANNRKITVEGNQDHKTTGNHLSLTEGDSGI
QVKGDLTQKINGVFSVDSNGDLTLQSGSKLTLRVGSSFVVIHAGGVDIKGPAINLNSGGSPGDVALPADP
AILKAAAAAGTMFVAHCPAKEKENSE
-
Nucleotide Sequence: 1971 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c2520200-2518230 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGGCAAACAGTACAGGATTACAGTTCACCGTTAAGGTCGGTGCCCTGGCGGCAGGCACTTTTGCAGTGG
TGGATTTCAGGCTGGATGAAGGATTGAACCGGCCTTTCAGCCTGTCGCTAAGTCTGGCGAGCGCACAGCC
GGATGTGGATTTCGGCGCGGTGCTGGACCAGCCGTGCGAGCTGATGATTTGGTATGAAGGCGAGCTGAAG
CGCCGGGTCAGCGGGATTGTCAGTGGCTTCACGCAGGGCGACACCGGTTTTCGGCGCACGCGCTATCAGA
TAGACGTCCGTCCGGCGCTGTGGCGACTGGGGCTGCGCACCAATGCTCGTATTTTTCAGGCACAGACGCC
GGATGCGATTATCAGCATGCTGCTGGAAGAGGCTGGAATCACTGACTACGCCTTTGCGCTGCGCAATGAG
CACGCAGTGCGGGAATATTGCGTGCAGTACCGGGAAAGCGATTTGGCGTTTGTCACCCGTCTGGCCGCCG
AGGAGGGCATGTATTTCTTCCACGAATACGAAGAGGGTAAACACCGGGTGGTGTTTGCCGACGACGCCGG
GGCGCTGACCAAAGGCCCGGAGCTGTTCTTCAATCTGGCGACACAAGGGCTGAGCGAGGGGGAATACATT
CGGCGCTTCCACTACGCAGAGCGGGTGAGCACTGCCGAAGTCGAGTTGAAAGACTACAGCTTCAAAACGC
CGGCTTACGGGCTGTCACACAAGAAGATGAGCGGTGAACTTGAGCACCAGCGTGAAAGCTACCAGCATTA
CGATTATCCGGGGCGCTATAAGCAAGACCCGAGCGGCAAGGCGTTCAGCGGCTACCGGCTGGATGCGCTG
CGGTCAGGGGCGGTGACGGGCGAAGGGGAATCCAACTGTGCGGGGCTGATGCCGGGCAGTACGTTTACCC
TGACGGAGCATCCGAATACGACGCTGAATGCGGTCTGGCAGACGGTGAGCGTGACGCACGTCGGGCAACA
GCCGCAGGCGCTGGAAGAGGAAAGCGGTGGTGAACCGACCACGATGAGTAACAGTTTTGCGGTGGTGAAA
GGGACAACAACGTGGCGCACCGCGATGCCGTATAAACCGATGGTGGACGGCCCGCAAATCGCCACTGTTG
TCGGTCCGGCTGGGGAAGAAATCTACTGTGACCCGTATGGTCGGGTGAAACTGCAATTCCCGTGGGACAG
ATACGGCGCCAGTAACGACCAGAGCTCCTGCTGGGTGCGCGTCAGTCAGGGCTGGGCGGGCGGTCAGTAC
GGCATGATTGCTATCCCCCGTATCGGCCATGAAGTGATCGTCAGCTTCCTGGAGGGCGATCCGGATCAGC
CGATTGTCACCGGGCGGACGTTCCACGTCACTAATCCGTCTCCCTATCCGCTGCCTGCCAACAAAACACG
GACCACGCTTCGTTCCAAAACCCATAAAGGCAAAGGCTTTAACGAACTCAGCTTCGAGGATGCGACCGAC
AACGAAGAGATCTTCCTTCATGCCCAGAAGAATATGGCTGTGCGGGTACTGAATTCCAAAGATGAGCGCG
TGGACTATAACCGCACGACGAGCATCGGACATGATGAAGAACTGGTGGTCGCCAACAATCGTAAAATCAC
GGTGGAAGGCAATCAGGATCACAAAACCACCGGCAACCATTTATCGCTGACCGAAGGCGATAGCGGCATA
CAGGTTAAGGGCGATCTGACGCAGAAAATCAACGGAGTATTCAGCGTAGACAGCAACGGCGATCTGACGC
TGCAAAGCGGCAGCAAACTGACGCTCCGCGTCGGAAGCAGCTTTGTGGTAATCCACGCTGGTGGAGTGGA
CATCAAAGGGCCAGCCATCAACCTGAATTCAGGCGGCAGTCCGGGCGATGTTGCCCTCCCTGCTGACCCG
GCGATATTGAAAGCAGCGGCGGCCGCAGGGACGATGTTTGTGGCGCACTGTCCGGCAAAGGAGAAAGAAA
ACAGTGAGTGA