SecReT6
Effector Protein ID: 253689604
-
SecReT6 ID353
T6SS typeA1
Gene symbol-
Locus tagPC1_3238
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3647323..3649359 [-]
Producttype VI secretion system Vgr family protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDC6DCT3
KEGG IDpct:PC1_3238
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-70, Aligned region: 30..328
Phage_GPD [PF05954], Evalue: 1.00E-70, Aligned region: 490..534
Phage_base_V [PF04717], Evalue: 9.60E-23, Aligned region: 367..459
Protein Sequence: 678 a.a.     [Download]
>gi|253689604|ref|YP_003018794.1| type VI secretion system Vgr family protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MANSTGLQFTVKVGALAAGTFAVVDFRLDEGLNRPFSLSLSLASAQPDVDFGAVLDQPCELMIWYEGELK
RRVSGIVSGFTQGDTGFRRTRYQIEVRPALWRLGLRTNARIFQAQKPEAIISMLLEEAGITDYAFALRNE
HAVREYCVQYRESDLAFITRLAAEEGMYFFHEYEEGKHRVVFADDAGALTKGPELFFNLATQGLSEGEYV
RRFHYAERVSTAEVELKDYSFKTPAYGLSHKKMSGELEHQRESYQHYDYPGRYKQDPSGKAFSGYRLDAL
RSGAVTSEGESNCAGLMPGSTFTLTEHPNATLNAVWQTVSVTHVGQQPQALEEESGGEPTTMSNSFAVVK
GTTTWRAAMPYKPMVDGPQIATVVGPTGEEIYCDPYGRVKLQFPWDRYGASNDQSSCWVRVSQGWAGGQY
GMIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPTPYVLPAHKTRTTLRTDTHKGSGFNELRFEDEAT
REQIYYHAQKDMDGVINNIHRQSVGRDQHLSVDQDQFQRVTRHRHRTIGKDDFENIGQDHHQEIGRSFIQ
KIGASFKRFIGGGEITRIEGSRQTTMSGSEETLIGAHQRVLVNTDSYLKAADIVLEAGQALTIKAPGGFI
KIDSAGVTISGTIVKINDGGAAGVGTAPVSITPEDPTKPTLPDAPDRR
-
Nucleotide Sequence: 2037 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3649359-3647323 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
GTGGCAAACAGTACAGGATTACAGTTCACCGTTAAGGTCGGTGCCCTGGCGGCAGGCACTTTTGCAGTAG
TGGATTTCAGGTTGGATGAAGGATTGAACCGGCCTTTCAGCCTGTCGCTGAGTCTGGCGAGTGCACAGCC
GGATGTCGATTTCGGCGCGGTGTTGGACCAGCCGTGCGAGCTGATGATTTGGTATGAAGGCGAGCTGAAA
CGCCGGGTCAGCGGGATTGTCAGTGGCTTCACGCAGGGCGACACCGGTTTTCGGCGCACGCGCTATCAGA
TAGAAGTTCGTCCGGCGCTGTGGCGACTGGGGCTGCGCACCAACGCCCGTATTTTTCAGGCACAAAAGCC
GGAAGCCATTATCAGCATGCTGCTGGAAGAGGCTGGCATCACTGACTACGCCTTTGCGCTGCGTAACGAG
CATGCGGTGCGGGAATATTGCGTGCAGTACCGGGAAAGCGATTTGGCGTTTATCACCCGTCTGGCTGCGG
AGGAAGGCATGTACTTCTTCCACGAATATGAAGAGGGCAAACACCGGGTGGTGTTTGCCGACGATGCGGG
GGCGCTGACCAAAGGCCCCGAGCTGTTCTTCAATCTCGCCACGCAGGGGCTGAGCGAGGGCGAATACGTT
CGGCGCTTCCACTACGCAGAGCGGGTGAGCACGGCTGAAGTCGAGCTGAAAGACTATAGCTTCAAGACGC
CGGCTTACGGGCTGTCGCACAAGAAGATGAGCGGTGAGCTGGAACACCAGCGTGAAAGTTACCAACATTA
CGACTATCCGGGACGCTATAAACAAGACCCGAGCGGCAAGGCGTTCAGCGGCTACCGGCTGGATGCGTTG
CGGTCTGGAGCCGTGACGAGCGAAGGGGAATCCAACTGCGCGGGGCTGATGCCGGGCAGTACGTTTACCC
TGACAGAGCACCCGAATGCGACGCTGAATGCGGTGTGGCAGACGGTGAGCGTGACGCACGTCGGGCAACA
GCCGCAGGCACTGGAAGAGGAAAGCGGTGGCGAACCAACCACGATGAGCAACAGTTTTGCGGTGGTGAAA
GGGACAACAACGTGGCGCGCCGCGATGCCGTATAAACCGATGGTGGACGGCCCGCAAATCGCCACTGTTG
TCGGTCCGACTGGGGAAGAAATCTACTGTGACCCGTATGGTCGGGTGAAACTGCAATTCCCGTGGGACAG
ATACGGCGCGAGCAATGACCAGAGCTCCTGCTGGGTGCGGGTGAGTCAGGGCTGGGCGGGCGGTCAGTAC
GGCATGATTGCTATCCCCCGTATCGGCCATGAAGTGATCGTCAGCTTCCTTGAAGGTGACCCGGATCAGC
CGATTGTCACCGGGCGTACCTTCCACGCGACCAATCCGACACCGTACGTTTTACCGGCACATAAAACGCG
CACGACGCTACGTACCGATACTCATAAAGGCAGTGGCTTCAACGAACTGCGTTTTGAGGATGAGGCGACG
CGTGAACAAATTTACTATCACGCTCAGAAAGATATGGATGGTGTCATCAACAACATCCATCGGCAGAGTG
TCGGGCGCGATCAGCACCTCAGCGTGGATCAAGATCAGTTCCAACGGGTTACTCGTCACCGTCACCGAAC
GATAGGTAAGGACGATTTTGAAAATATCGGTCAGGACCATCATCAGGAAATTGGTCGGAGCTTTATTCAG
AAGATTGGTGCGTCGTTCAAACGTTTCATCGGCGGGGGAGAGATTACCCGTATCGAAGGGAGTCGGCAGA
CTACGATGTCCGGTTCTGAAGAGACGCTGATCGGTGCGCACCAGCGTGTTCTGGTGAATACGGACAGCTA
CCTGAAAGCCGCCGATATCGTACTGGAAGCAGGGCAAGCGTTGACCATCAAGGCGCCGGGCGGTTTTATC
AAGATTGATAGCGCGGGCGTGACGATTTCCGGGACGATTGTAAAAATCAACGACGGCGGTGCGGCTGGCG
TAGGGACTGCGCCGGTATCGATTACGCCAGAAGATCCGACGAAGCCCACGCTGCCGGATGCACCAGACAG
ACGTTAA