SecReT6
Effector Protein ID: 253989894
-
SecReT6 ID356
T6SS typeA4b
Gene symbol-
Locus tagPAU_02414
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2760185..2760670 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDB6VL63
KEGG IDpay:PAU_02414
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-32, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|253989894|ref|YP_003041250.1| hypothetical protein PAU_02414 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MAIPLYMYIKDDGGSDIKGSVDVYGREGSIEVLGLHHSVSIANDDNTGKLTGTRKHLPFMIEKEIDSSSP
YLYKALTTGQTLKSAELKWYKINEHGQEKEYFNTFMENVKVVNIVPVMFDIKYASKEKFNHMEIVELRYE
KIIWKYNTGNIIHSDSWNERV
-
Nucleotide Sequence: 486 bp     [Download]
>gi|253987483|ref|NC_012962.1|:2760185-2760670 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCTATTCCTCTCTATATGTACATAAAAGACGATGGCGGATCAGATATTAAAGGTTCTGTTGATGTCT
ATGGTAGAGAAGGCAGTATTGAGGTTTTGGGTCTTCATCATAGTGTCAGTATCGCCAATGATGATAATAC
GGGAAAATTGACTGGAACGAGGAAACATCTCCCATTTATGATTGAAAAAGAAATTGACTCGTCATCACCC
TATCTTTATAAGGCACTAACCACAGGGCAAACATTAAAATCAGCAGAGTTAAAATGGTATAAAATAAATG
AACATGGACAAGAAAAAGAGTATTTCAATACTTTCATGGAAAATGTAAAAGTGGTTAATATTGTTCCTGT
TATGTTCGATATAAAGTATGCATCAAAAGAAAAATTCAATCATATGGAAATCGTTGAACTTCGCTACGAA
AAAATCATCTGGAAGTATAATACTGGAAATATAATTCATTCTGATAGCTGGAATGAGAGAGTTTAA