SecReT6
Effector Protein ID: 259907300
Hcp
SecReT6 ID331
T6SS typeA3
Gene symbolHcp
Locus tagEpC_06240
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]723971..724453 [+]
Productsecretion apparatus virulence factor
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDD0FP60
KEGG IDepy:EpC_06240
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.00E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|259907300|ref|YP_002647656.1| secretion apparatus virulence factor [Erwinia pyrifoliae Ep1/96]
MAIDMYLKVDGVTGESKDANHTGWIDVTSFSWGATQPGNMSVGGGGGAGKVNFNDLHVDAKIDKAVTALL
KNCASGKHVGKVEVSVCKAGGTQIEYTRITLEDVLVTRVEFSGAGNGETLGVTYAFQAAKVKQQYWEQST
TGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|259906682|ref|NC_012214.1|:723971-724453 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGGCTATTGATATGTATTTGAAAGTTGACGGTGTTACCGGTGAATCTAAAGATGCTAACCACACCGGCT
GGATCGATGTGACTTCTTTCTCCTGGGGCGCTACCCAGCCGGGCAACATGTCCGTAGGCGGCGGCGGCGG
TGCCGGTAAAGTGAACTTTAACGATCTGCACGTTGATGCAAAAATCGATAAAGCAGTTACCGCGCTGCTG
AAAAACTGCGCCAGCGGTAAGCACGTCGGTAAAGTAGAAGTTTCCGTATGTAAAGCGGGCGGCACTCAGA
TTGAGTACACCCGTATTACTCTGGAAGACGTGCTGGTAACCCGCGTCGAGTTCTCGGGTGCAGGAAACGG
GGAAACTTTGGGCGTAACCTACGCATTCCAGGCTGCCAAAGTGAAACAGCAGTACTGGGAGCAGAGCACC
ACCGGTGGTAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATTAAAGAGAATAAAGAAGCGTAA