SecReT6
Effector Protein ID: 260595868
hcp1
SecReT6 ID362
T6SS typeA3
Gene symbolhcp1
Locus tagCTU_00760
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]74150..74632 [+]
Productprotein hcp1
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDC9Y423
KEGG IDctu:CTU_00760
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.90E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|260595868|ref|YP_003208439.1| hcp1 gene product [Cronobacter turicensis z3032]
MAIDMFLKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCSSGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTA
TGGKGAETSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|325295716|ref|NC_013282.2|:74150-74632 Cronobacter turicensis z3032 chromosome, complete genome
ATGGCTATTGATATGTTCCTGAAAGTAGACGGTGTAACCGGCGAATCTAAAGATTCTAACCACACCGGCT
GGACCGACATCACCTCTTTTTCCTGGGGCGCATCCCAGCCGGGTAATATGAGCGTGGGCGGCGGCGGCGG
TGCCGGTAAAGTGAATTTCAACGATCTGCACGTTAACGCGCTGATCGACAAATCCACCACCGCTATCCTG
AAGCACTGCTCCAGCGGTAAGCACCTGACCAAAGTTGAGCTGTCTGTCTGCAAAGCAGGCGGCCAGCAGG
TGGAATACACCCGTATCACTCTGGAAGATGTGCTGGTGACTTCCGTTCAGTACACCGGTGCTGACAACGG
CGACACCGTTGGCGTTACTTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACTGCG
ACCGGCGGTAAAGGCGCAGAAACCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCGTAA