SecReT6
Effector Protein ID: 260595886
-
SecReT6 ID362
T6SS typeA3
Gene symbol-
Locus tagCTU_00940
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]94460..98644 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDC9Y441
KEGG IDctu:CTU_00940
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 270..282
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 352..417
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 402..430
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 474..497
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 489..510
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 510..546
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 562..578
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 574..610
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 616..652
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 641..672
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 679..716
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 721..774
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 788..814
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 840..875
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 884..913
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 903..932
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 922..959
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 975..1003
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 1026..1055
RHS_repeat [PF05593], Evalue: 9.00E-69, Aligned region: 1070..1085
DUF3990 [PF13151], Evalue: 1.70E-15, Aligned region: 1254..1351
PAAR_motif [PF05488], Evalue: 6.40E-15, Aligned region: 19..139
RHS [PF03527], Evalue: 4.30E-14, Aligned region: 656..672
RHS [PF03527], Evalue: 4.30E-14, Aligned region: 839..852
RHS [PF03527], Evalue: 4.30E-14, Aligned region: 908..931
RHS [PF03527], Evalue: 4.30E-14, Aligned region: 1036..1047
RHS [PF03527], Evalue: 4.30E-14, Aligned region: 1142..1179
DUF4595 [PF15283], Evalue: 3.90E-05, Aligned region: 381..427
DUF4595 [PF15283], Evalue: 3.90E-05, Aligned region: 476..520
DUF4595 [PF15283], Evalue: 3.90E-05, Aligned region: 615..653
DUF4595 [PF15283], Evalue: 3.90E-05, Aligned region: 692..715
DUF4595 [PF15283], Evalue: 3.90E-05, Aligned region: 772..809
DUF4150 [PF13665], Evalue: 0.001, Aligned region: 26..43
DUF4150 [PF13665], Evalue: 0.001, Aligned region: 98..134
Protein Sequence: 1394 a.a.     [Download]
>gi|260595886|ref|YP_003208457.1| unnamed protein product [Cronobacter turicensis z3032]
MTDDISNMATGIGNAIFPPSPAGFIATGSANVLTNKLPAARAAGKLTPGDTPPPEPQKPGSFADYGGMLL
SAAAQFGSEMWQPTVATAAPGTSSLELDTVLCDKHSGPQYLAEGSKSVFINGQPAVRAKDRTTCEATISD
DVSPNVIIGGETLTVRDIKSGKTAGLAVAMIALSLIRGRPGNILKNMPCALVSAGAGMLTDMAINAVFAS
FHPVHAATGVKVLNDNNELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATAFDSYLTLEDGEATWFDET
GRELRFTLPPLNQALYSISEGLIVRRNENGDVAIADDDGAVWRLFKPTRGNPSVLRLASLSDEYGNALET
GWDEHGRLVRIHDAPCAIDVTLRYEDERFPRRVTSASHFDGDKTWPLVTYRYDGRGQLTAVTDATGITTR
EYRYNDAGLMIWHRLPGGLESEYRWEKFDHWRVVENRTSTGDGCRIAYDLTAGLTTVTQYDGQTRQHYWN
KQGLITRFVDERGETWRYEWNEHDLLTRRIDPLGNATTFVYDDMGNRVQEVDAEGNIRATQWLEHRALPA
AITEADGTATRFYYDEHHGLERIVDALGQTTLLRRDECGQIVEEVDAAGNSRHQEYNDAGQVIRATDCSG
RVTRYRYHPLGWLSTAISADGEETRYHYDAAGRPIQLERPEGWEERLLWNARGLPEAHEGADGKRSEFTY
DAAGRLVSTSNPKGETVRRRWDSRGRLIELENEKGEAYQFRWGADSRLLEEESLDGVITRYGYDACGRTI
ARTFAAGHPEAITHTFAWSAAGQLLSRTTPEGQIRYDYTPAGLISRIALHASLAENVWSREAEQELRFEY
DALGRVIGEQSENGALGWTYDALGNRTSVQLPDGRMLKNHFYGSGHLLSIALDNLPVTDFTRDELHRELS
RTQGLLTSRSEYDRLGRLTRRDVFTGDAQRPAPRRWSRRWDYDYRNNLIREERDDNPFSWYRWKYDSAGR
LLTQDGTLPGQEQWQWDAAGNPLDDSATQTVRFNRVTQLNGIQWRYDIHGRTVEKDNGQTRWRYRYDGEH
RLTDVISQPRDRNKPQVEVSFRYDPLGRRISKTRRQFLAGQPTGKAVTTRFVWEGFRLLQEIHDEVPLTY
VYSDPHSYEPLARIDGTQAPDIYWFHNQPNGTPERLTDVEGRVRWEGRNSAWGKLAHESTPLPTGYNQNL
RMQGQYLDRETGLHYNLFRYYDPDCGRFTQHDPIGLAGGINLYQFAPNALGWVDPWGLNKTTFYHAGDIQ
GDIDPSKGRVGLDFNPANHGGFYVTTDRAQATEWANMRNHPSITEFEIPNSELEKLNIKTFDKANSEWAE
FVTKGRENTLTHNYDAVSGPMLANPGAVRKGASPRPIGQQLAVFTSKAAKLFNKYKSKGCKKND
-
Nucleotide Sequence: 4185 bp     [Download]
>gi|325295716|ref|NC_013282.2|:94460-98644 Cronobacter turicensis z3032 chromosome, complete genome
ATCACGGATGACATCAGTAATATGGCGACGGGGATCGGCAATGCGATTTTCCCGCCATCACCGGCTGGTT
TCATCGCCACCGGCTCTGCCAACGTGCTGACCAACAAACTTCCGGCTGCTCGCGCGGCAGGCAAACTCAC
GCCAGGCGACACGCCGCCGCCGGAGCCGCAAAAGCCTGGCAGTTTCGCCGACTACGGCGGTATGTTGCTT
TCCGCAGCGGCGCAGTTCGGCAGCGAGATGTGGCAGCCTACGGTCGCGACTGCCGCGCCAGGGACCTCGT
CGCTGGAGCTGGATACCGTGCTTTGCGATAAACATTCCGGCCCGCAATACCTGGCGGAAGGGTCAAAAAG
CGTCTTCATTAACGGTCAGCCTGCCGTACGCGCCAAAGATCGCACCACCTGCGAAGCCACTATTTCGGAC
GATGTGTCGCCAAACGTCATTATCGGTGGTGAAACGCTGACGGTGCGCGACATCAAAAGCGGTAAAACCG
CAGGGCTGGCGGTAGCGATGATTGCCCTTTCGCTCATTCGAGGGCGCCCCGGCAACATTCTTAAAAATAT
GCCCTGCGCTTTAGTGTCGGCAGGCGCCGGTATGCTCACGGATATGGCGATAAACGCGGTTTTCGCCTCA
TTCCACCCCGTTCATGCCGCCACCGGCGTGAAGGTCCTGAACGACAATAATGAACTGGACTTCTCACTGC
CTGGTCGTTTTCCCCTGCGCTGGCAGCGCAGCTATAACAGCTTAACCACCCGCGAAGGATTGTTCGGCCT
TGGCTGGGCCACGGCATTCGACAGCTACCTGACGCTGGAAGATGGCGAAGCCACCTGGTTTGACGAGACC
GGCCGTGAGTTGCGCTTTACGCTGCCGCCGCTGAACCAGGCGCTATACAGTATCAGCGAAGGGCTTATCG
TTCGACGCAATGAGAACGGCGATGTGGCGATCGCCGACGACGATGGCGCCGTCTGGCGTCTGTTCAAACC
CACCCGCGGCAACCCTTCAGTACTGCGCCTCGCGTCGCTGAGCGACGAATATGGCAATGCGCTGGAAACT
GGCTGGGATGAACATGGCCGCCTGGTGCGCATTCACGACGCGCCGTGCGCCATTGATGTCACGCTGCGCT
ATGAGGATGAGCGCTTTCCACGGCGTGTCACTTCAGCCTCACATTTTGACGGCGACAAAACGTGGCCGCT
GGTGACTTATCGTTACGACGGACGCGGGCAACTGACGGCGGTCACCGACGCAACCGGCATCACGACGCGC
GAATATCGCTATAACGATGCTGGCCTGATGATCTGGCACCGGTTACCCGGCGGGCTGGAGAGTGAATATC
GCTGGGAGAAATTCGATCACTGGCGCGTGGTAGAGAACCGCACCAGCACCGGCGACGGTTGCCGTATCGC
TTACGATCTGACCGCAGGGCTGACGACGGTCACGCAATACGACGGCCAGACGCGTCAGCATTACTGGAAT
AAGCAGGGGCTTATCACTCGTTTTGTCGATGAGCGCGGCGAAACCTGGCGTTACGAGTGGAATGAACACG
ATCTGCTGACCCGCCGTATCGACCCACTGGGTAACGCGACCACCTTCGTCTATGACGACATGGGTAACCG
GGTGCAAGAGGTGGATGCTGAAGGCAACATCCGCGCCACGCAGTGGCTGGAGCATCGTGCGTTACCTGCG
GCTATCACTGAGGCAGACGGTACCGCCACACGTTTTTACTACGATGAGCACCATGGGCTGGAGCGCATCG
TCGATGCGCTCGGGCAAACCACACTGTTGCGCCGCGACGAGTGTGGACAAATCGTGGAAGAGGTGGATGC
GGCGGGTAACAGCCGCCACCAGGAATATAACGACGCGGGGCAAGTCATTCGCGCGACGGACTGTTCGGGG
CGCGTTACCCGTTACCGCTATCACCCGCTTGGTTGGTTAAGTACTGCTATCTCAGCGGATGGCGAAGAGA
CCCGCTATCACTACGATGCCGCAGGGCGTCCGATCCAGCTGGAACGCCCGGAAGGCTGGGAAGAACGCCT
GTTATGGAATGCGCGCGGTCTGCCTGAGGCGCATGAAGGGGCTGACGGCAAGCGCAGCGAATTTACTTAT
GATGCTGCGGGGCGTCTTGTTTCAACCTCTAACCCGAAGGGGGAGACAGTGCGCCGCCGCTGGGACAGTC
GCGGCCGCCTGATTGAACTCGAAAATGAAAAGGGCGAGGCATACCAGTTCCGCTGGGGCGCGGATTCCCG
GCTGCTGGAGGAAGAAAGTTTAGACGGCGTGATTACCCGCTACGGGTATGACGCCTGTGGACGCACCATC
GCTCGTACTTTCGCCGCCGGGCATCCGGAAGCGATAACCCATACTTTCGCCTGGAGCGCGGCCGGGCAGC
TTCTTTCACGCACGACGCCGGAAGGCCAGATCCGCTACGACTACACGCCAGCAGGGTTAATCAGCCGTAT
CGCACTGCATGCATCGCTTGCGGAAAACGTCTGGAGCCGCGAGGCGGAACAGGAGCTGCGCTTTGAGTAT
GACGCCCTGGGCCGCGTCATCGGCGAACAAAGCGAAAACGGCGCGCTGGGCTGGACTTACGATGCGCTCG
GCAACCGTACTTCTGTGCAACTGCCCGACGGGCGAATGCTGAAAAACCACTTCTACGGCAGCGGTCATCT
GTTGTCCATTGCGCTCGATAACCTGCCGGTCACGGATTTTACCCGTGATGAACTGCACCGCGAGCTGAGC
CGTACACAGGGGTTACTCACGAGCCGCAGCGAGTATGACCGGCTGGGCCGCCTGACGAGGCGCGATGTTT
TCACCGGCGATGCGCAACGCCCCGCGCCGCGCCGCTGGTCTCGCCGCTGGGATTATGATTATCGCAACAA
CCTCATCCGCGAGGAGCGCGACGATAACCCCTTCAGCTGGTACCGCTGGAAATATGACAGCGCAGGGCGT
CTGCTGACGCAGGACGGCACGCTGCCGGGCCAGGAACAGTGGCAGTGGGACGCGGCGGGCAATCCGCTTG
ACGACAGCGCGACGCAGACGGTGCGCTTTAACCGCGTGACGCAGCTTAACGGCATCCAGTGGCGTTATGA
CATTCATGGCCGCACGGTAGAGAAAGATAACGGACAGACCCGCTGGCGCTACCGCTACGACGGCGAGCAC
CGTCTGACGGACGTTATCAGCCAGCCACGTGACCGCAATAAGCCGCAGGTGGAGGTGAGCTTCCGCTACG
ACCCGCTGGGGCGGCGCATCAGCAAGACCCGCCGTCAGTTTCTGGCGGGGCAACCCACCGGTAAAGCGGT
CACCACGCGCTTTGTCTGGGAAGGGTTCCGGCTGCTACAGGAAATCCATGACGAGGTACCGCTCACCTAC
GTTTACAGCGACCCGCACAGCTACGAGCCGCTGGCGCGCATCGACGGCACGCAGGCCCCGGATATTTACT
GGTTCCACAACCAGCCGAACGGCACGCCGGAGCGGCTGACCGATGTGGAAGGCCGGGTGCGCTGGGAAGG
GCGAAACAGCGCGTGGGGCAAGCTGGCGCATGAGTCGACGCCGCTGCCGACGGGCTATAACCAGAACCTG
CGTATGCAGGGCCAGTACCTGGATCGCGAAACCGGGCTTCACTACAATTTATTTCGTTACTATGACCCGG
ACTGCGGCAGGTTCACGCAGCACGACCCGATTGGTCTGGCGGGCGGTATCAATCTGTACCAGTTTGCGCC
GAATGCGCTGGGATGGGTGGATCCGTGGGGGTTGAATAAGACAACATTTTATCATGCTGGAGACATACAA
GGGGATATCGATCCATCAAAAGGGCGTGTTGGATTAGATTTTAATCCCGCTAATCATGGGGGTTTTTACG
TTACAACCGACAGGGCTCAGGCGACCGAATGGGCGAATATGCGAAATCATCCATCCATAACAGAATTCGA
AATCCCAAATTCAGAGTTAGAAAAACTAAACATAAAAACCTTTGATAAAGCAAATAGCGAATGGGCTGAG
TTTGTAACGAAGGGACGAGAAAATACGTTAACCCATAATTATGATGCTGTTAGTGGACCTATGCTCGCCA
ATCCAGGCGCAGTGCGAAAAGGTGCTTCTCCACGGCCCATAGGCCAACAATTAGCTGTATTCACTAGTAA
AGCAGCAAAACTATTCAATAAATACAAAAGTAAGGGTTGTAAAAAAAATGATTGA