SecReT6
Effector Protein ID: 260597009
hcp1
SecReT6 ID363
T6SS typeN/A
Gene symbolhcp1
Locus tagCTU_12170
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1276784..1277269 [+]
Productprotein hcp1
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDC9XYL2
KEGG IDctu:CTU_12170
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.60E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|260597009|ref|YP_003209580.1| hcp1 gene product [Cronobacter turicensis z3032]
MAQDMFIKIDGIEGESLDATHKNEIQVLAWHWSVSQHSNMHSGSGGGSGKATVADFCFEHYVDKATPNLV
SYCLTGKHIKNIQFVIRKAGGDPLEYLLIKFTDVIITGVDVMGSLEDETRPRESVRFSFTKMTEDYVMQN
AEGQKAGVISASYDVKANLHG
-
Nucleotide Sequence: 486 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1276784-1277269 Cronobacter turicensis z3032 chromosome, complete genome
ATGGCACAGGATATGTTTATTAAAATTGATGGTATCGAAGGGGAGTCTTTAGATGCCACTCATAAGAATG
AAATTCAGGTTCTGGCATGGCACTGGAGTGTTTCGCAGCACTCTAATATGCATAGCGGTTCCGGTGGGGG
CTCCGGTAAAGCGACCGTGGCTGACTTCTGCTTTGAGCACTATGTGGATAAAGCTACGCCTAATCTGGTG
AGTTACTGCCTGACCGGCAAGCATATTAAAAATATTCAGTTTGTTATTCGTAAAGCGGGCGGCGATCCGC
TGGAATATCTGCTTATCAAATTCACTGATGTCATTATTACTGGCGTGGATGTTATGGGTTCGCTGGAAGA
TGAAACGCGGCCGCGTGAATCGGTACGCTTCTCGTTTACCAAAATGACTGAAGATTATGTGATGCAGAAT
GCAGAAGGTCAGAAAGCGGGTGTTATTTCTGCCAGCTATGACGTTAAAGCTAACCTGCACGGCTAA