SecReT6
Effector Protein ID: 260597725
-
SecReT6 ID364
T6SS typeA2
Gene symbol-
Locus tagCTU_19330
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2025337..2025828 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDC9Y2Y2, C9Y2Y2
KEGG IDctu:CTU_19330
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.50E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|260597725|ref|YP_003210296.1| unnamed protein product [Cronobacter turicensis z3032]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHTLYIPTDNNTGKLTGTRIHTPFLFTKEIDASSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPLMHDIKDPSKEKHNHLERIELRYE
KITWTYKDGNIIHSDSWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2025337-2025828 Cronobacter turicensis z3032 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAGGACGATGGCGGCGCGGACATCAAGGGTTCCGTTGACGTGA
AGGATCGCGAAGGCAGCATCGAGGTGGTGGCGCAGGAGCACACCCTGTACATCCCGACCGACAACAACAC
CGGCAAGCTGACGGGTACCCGTATTCACACGCCGTTCCTGTTCACTAAGGAGATCGACGCGTCCAGCCCG
TACCTCTACAAGGCGGTGACCACCGGCCAGACCCTGAAATCGGCAGAGTTCAAATGGTACCGCATTAACG
ACGCGGGCCAGGAAGTGGAGTACTTCAACACGAAACTGGAGAACGTGAAGCTGGTGAAAGTGGCGCCACT
GATGCACGACATCAAGGACCCGTCCAAGGAGAAGCACAACCATCTTGAGCGCATTGAACTGCGCTACGAA
AAAATCACCTGGACCTACAAGGACGGCAACATCATTCATTCCGACTCCTGGAACGAACGTACCACCGCCT
GA