SecReT6
Effector Protein ID: 260866375
-
SecReT6 ID367
T6SS typeA1
Gene symbol-
Locus tagECO111_0235
StrainEscherichia coli O111:H- str. 11128
Repliconchromosome [GenBank: NC_013364] [Browse all T6SS(s) in this replicon]
Location [Strand]261961..262479 [+]
ProductHcp-like protein
Effector typeProtein
Homologous effectorECA4275
DescriptionHcp protein
UniProt IDC8UH93
KEGG IDeoi:ECO111_0235
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-34, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0061, Aligned region: 95..136
Protein Sequence: 172 a.a.     [Download]
>gi|260866375|ref|YP_003232777.1| Hcp-like protein [Escherichia coli O111:H- str. 11128]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIF
TVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|260866153|ref|NC_013364.1|:261961-262479 Escherichia coli O111:H- str. 11128, complete genome
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCG
CTGATTCTGTCGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAA
CGTTACTGTCCCGACCGATCCTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTT
ACCGTGGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCA
CTGAACTTCACTGGTGGCGTACCTCTGTGGAAGGCAAACAGGAGCATTATTTCACTACCCGCCTGACTGA
TTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGGCGAAACGCGAGTTCACCCAG
TTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACCTCCGGTGCCG
ACGACTGGCGCGCACCGCTGGAAGCATAA