SecReT6
Effector Protein ID: 261819430
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_0061
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]65245..65763 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorECA4275
DescriptionHcp protein
UniProt IDD0KCH6
KEGG IDpwa:Pecwa_0061
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-34, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|261819430|ref|YP_003257536.1| type VI secretion system effector [Pectobacterium wasabiae WPP163]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSTGEMLPTTTLKWYRTSVEGKQEHFFSTILTDATIVDIDCKMPHCQDPAKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c65763-65245 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACACAGGGCAACATTACTGCTGGTGCTTTCACCT
CTGACTCTGTCGGCAACATCTACGTGGAAGGCCACGAAGACGAGATGCTGGTTCAGGAATTTAAGCACAT
CGTCACCGTACCAACCGACCCGCAGTCCGGTCAGCCATCCGGTCAGCGCGTCCACAAACCGTTCAAATTC
ACCGTCGCACTGAACAAAGCGGTGCCACTGCTGTACAACGCGCTGTCTACTGGTGAAATGCTGCCGACCA
CGACCCTGAAGTGGTATCGCACCTCAGTGGAAGGCAAGCAGGAACACTTCTTCTCTACCATCCTGACCGA
TGCCACCATCGTTGATATCGACTGCAAAATGCCACACTGTCAGGACCCGGCCAAGCTAGACTACACCCAA
CTGATTGAAGTCTCGCTGGCTTACCGTAAAATCGACTGGGAGCACACTGTCGCTGGGACCTCTGGCTCTG
ACGACTGGCGTGCGCCGGTCGAAGCCTAA