SecReT6
Effector Protein ID: 261819699
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_0345
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]383546..385405 [+]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDD0KES4
KEGG IDpwa:Pecwa_0345
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.80E-68, Aligned region: 30..328
Phage_GPD [PF05954], Evalue: 6.80E-68, Aligned region: 533..574
Phage_base_V [PF04717], Evalue: 1.60E-22, Aligned region: 367..459
Protein Sequence: 619 a.a.     [Download]
>gi|261819699|ref|YP_003257805.1| ImpA family type VI secretion-associated protein [Pectobacterium wasabiae WPP163]
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQSFALSLNLASALPDVDFGAVLDQPCELLIWFEGELK
RRVSGIISGFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEEAGITDYAFSLRHD
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGEYV
HRFRYAERVSIAEVALKDYSFKTPAYGLLHKKMSSELAHQRESYQHFDYPGRFKKDPSGKAFSRYRLDAL
RAGAMTGAGDSNAAMLMPGNSFMLTEHPNLPLNTGWQVVAITHSGQQPQALEEESGGEPTTYSNSFEVIS
AKTTWRADLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTATHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRSTGVGGSHEEKVRYDQLSVVGRDQTIEVVHNQETKIQGTQGVFVGEGRKT
DVTSNDTLTVTGHITVTSTGGTITLKAGASSLTLCNNGDIEIKGVNVNVIGSSRIDLNK
-
Nucleotide Sequence: 1860 bp     [Download]
>gi|261819370|ref|NC_013421.1|:383546-385405 Pectobacterium wasabiae WPP163 chromosome, complete genome
GTGGCCAACAGTACAGGATTACAGTTCACCGTAAAGGTCGGCGCATTACCGGCCTCGACGTTTGCGGTGG
TCGATTTTCAGCTCAGCGAGGCGCTTAACCAGTCGTTTGCCCTGTCCCTCAATCTGGCCAGCGCCCTGCC
GGATGTGGATTTTGGCGCGGTGCTGGACCAGCCCTGTGAGCTGCTGATTTGGTTCGAAGGCGAGTTGAAG
CGACGGGTGAGCGGGATAATCAGCGGCTTTGCCCAGGGTGACACCGGCTTTCGCCGCACCCGCTATCAGG
CGGAAGTGCGTCCGGCGTTGTGGCGACTCGGCTTACGCACCAACGCCCGCATTTTTCAGGCGCAGAAGCC
GGAGGCGATTATCGGCACCCTGCTGGAGGAAGCCGGGATTACCGACTACGCCTTCTCGTTACGTCATGAC
CATGCCCCGCGTGAATACTGCGTGCAGTACCGGGAAAGTGATTTGGCGTTTGTCACCCGACTGGCCGCAG
AGGAAGGGCTGTACTTCTTCCACGAGTTTGAGGAAGGCAAACACCGCGTCGTCTTTGCCGATGATGCCGG
GGCGTTGGCCAAAGGCCCTGAACTGTTCTTCAACCTCGCCACGCAGGGGCTGAGTGAGGGTGAATACGTC
CACCGTTTCCGCTACGCCGAGCGGGTCAGCATCGCCGAGGTGGCGCTCAAGGACTACAGCTTCAAAACCC
CGGCCTATGGCCTGCTGCACAAGAAGATGAGCAGCGAACTGGCACACCAGCGCGAAAGCTATCAGCACTT
TGACTACCCCGGACGCTTTAAAAAAGACCCGAGCGGCAAGGCGTTCAGCCGCTACCGGCTGGATGCACTG
CGTGCCGGGGCCATGACCGGCGCGGGGGACTCCAACGCCGCGATGCTGATGCCGGGCAACAGTTTCATGC
TCACCGAGCACCCCAACCTGCCCCTCAACACTGGCTGGCAAGTGGTTGCCATCACCCACAGCGGGCAGCA
ACCGCAGGCGCTGGAAGAAGAAAGCGGCGGCGAACCGACCACCTACAGCAACAGCTTTGAGGTTATCAGC
GCCAAAACCACCTGGCGGGCGGACCTGCCGTACAAGCCGATGGTCGATGGCCCGCAGATTGCCACGGTGG
TGGGCCCGGCCGGTGAAGAAATCTACTGTGACGAATACGGCCGCATCAAGCTGCAGTTCCCGTGGGACCG
CTACGGCGCAAGTGATGACCAAAGCTCCTGCTGGGTGCGGGTGAGTCAGGGCTGGGCGGGCGGCCAGTAC
GGGCTGATAGCCATCCCGCGCATCGGTCATGAAGTGATTGTCAGCTTCCTCGAAGGCGACCCGGACCAGC
CGATAGTGACCGGCAGAACCTTTCATGCCACCAATCCGTCGCCGTACCCGTTACCGGCCAACAAGACACG
TACCTCGCTGCGGACCGCCACGCACAAGGGCGCCGGGTTCAATGAACTGCGCTTTGAAGACCAGGCCGGG
CAGGAGGAAGTGTTTATCCATGCCCAGAAGGACATGAACACCGTGGTGTTGAATAACCGCAGCACCGGTG
TCGGGGGGAGTCATGAGGAAAAAGTCAGGTACGATCAGCTCAGCGTGGTGGGACGAGATCAGACGATTGA
GGTTGTCCACAATCAGGAGACCAAGATCCAGGGCACCCAGGGGGTCTTCGTCGGTGAGGGCCGTAAAACC
GATGTCACGTCCAACGACACGCTGACTGTGACGGGCCACATTACCGTGACATCTACCGGTGGCACCATCA
CGCTGAAGGCGGGAGCGAGTTCGCTGACCCTTTGCAATAATGGCGACATTGAAATCAAGGGCGTGAACGT
CAATGTGATCGGCAGCTCGCGTATCGATTTGAATAAATAA