SecReT6
Effector Protein ID: 261819863
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_0533
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]570784..571158 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDD0KG45
KEGG IDpwa:Pecwa_0533
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.40E-23, Aligned region: 15..108
Protein Sequence: 124 a.a.     [Download]
>gi|261819863|ref|YP_003257969.1| type VI secretion system effector [Pectobacterium wasabiae WPP163]
MRQCPQSNSETFWAMNYKPFKFTVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDA
TIVDVNCQMPHCQDPAKLDYTQLIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
-
Nucleotide Sequence: 375 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c571158-570784 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCGGCAATGCCCCCAGAGCAACAGCGAAACGTTCTGGGCGATGAACTACAAACCGTTCAAGTTCACCG
TCGCGCTGAACAAAGCGGTGCCGCTGATGTACAACGCCCTCGCCTCCGGCGAAATGCTGCCAACCGTCAC
CCTGAAGTGGTATCGCACCTCGGTAGAAGGAAAACAGGAGCACTTCTTCTCTACCGTGCTGACCGATGCC
ACCATCGTTGACGTTAACTGCCAGATGCCACACTGCCAGGACCCGGCCAAGCTGGACTACACCCAACTGA
TTGAAGTCTCGCTGGCCTACCGCAAAATCGACTGGGAGCACACCGTCGCCGGCACCTCCGGCTCTGACGA
CTGGCGCGCGCCGGTCGAAGCCTAA