SecReT6
Effector Protein ID: 261819972
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_0647
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]687024..687542 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDD0KGT7
KEGG IDpwa:Pecwa_0647
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-34, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|261819972|ref|YP_003258078.1| type VI secretion system effector [Pectobacterium wasabiae WPP163]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNSLASGEMLPTVTLKWYRTSVEGKQEHFFSTILTDATIVDIDCKMPHCQDPSKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|261819370|ref|NC_013421.1|:687024-687542 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGGAAAACGCAGGGCAATATCACCGCAGGGGCGTTCACCT
CTGACTCTGTCGGCAACATCTATGTGGAAGGCCACGAAGATGAAATGCTGGTGCAGGAATTCAAACACGT
TGTCACCGTACCAACCGACCCGCAGTCTGGTCAGCCATCCGGCCAGCGTGTCCACAAACCGTTCAAATTC
ACCGTGGCACTGAACAAAGCGGTTCCGCTGATGTACAACTCTCTGGCATCTGGCGAAATGCTGCCGACCG
TCACACTGAAGTGGTATCGCACCTCGGTGGAAGGCAAGCAGGAGCACTTCTTCTCTACCATCCTGACTGA
TGCCACCATCGTGGATATCGACTGCAAAATGCCACACTGTCAGGACCCGTCCAAGCTGGACTACACCCAG
CTGATTGAAGTGTCGCTGGCCTACCGCAAAATTGACTGGGAGCACACCGTTGCCGGTACGTCCGGCTCTG
ATGACTGGCGTGCACCGGTCGAAGCGTAA