SecReT6
Effector Protein ID: 261819973
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_0648
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]687663..689492 [+]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDD0KGT8
KEGG IDpwa:Pecwa_0648
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-67, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 7.90E-23, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 0.00039, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 0.00039, Aligned region: 516..538
Gp5_C [PF06715], Evalue: 0.00039, Aligned region: 549..565
Protein Sequence: 609 a.a.     [Download]
>gi|261819973|ref|YP_003258079.1| ImpA family type VI secretion-associated protein [Pectobacterium wasabiae WPP163]
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQPFALSLNLASALPDVDFGAVLDQPCELMVWYEGVLQ
RRVSGIISAFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEESGITDYAFALRHD
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVVFADDAGALSKGPELFFNLATQGLSEGEYV
RRFRYAEAVSTAEVALKDYSFKTPAYGLLHSKISGELAHQRESYQHYDYPGRFKQDPSGKAFTGYRLDAL
RAGAMTGSGESNAAMLMPGSSFTLTEHPNPTLNSGWQLVAITHSGQQPQALEEESGGEPTTYSNSFEVIS
AKSTWRADLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGSSDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPAPYPLPANKTRTSIRTSTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRTTSVTADHTESVGGNQAVSVVKDQSTEIQGQQSIAVTKNRNTVVDDNDSL
QVKNNIAIQSQKGDILIATDKGFIGIGADGVINIKGTHIVINGQQIDLN
-
Nucleotide Sequence: 1830 bp     [Download]
>gi|261819370|ref|NC_013421.1|:687663-689492 Pectobacterium wasabiae WPP163 chromosome, complete genome
GTGGCAAACAGTACAGGATTACAGTTCACGGTAAAGGTCGGGGCATTGCCTGCATCAACCTTTGCCGTGG
TGGATTTTCAGCTCAGCGAGGCACTTAACCAGCCGTTTGCCCTGTCGCTGAATCTGGCGAGTGCCTTGCC
GGATGTGGATTTCGGCGCTGTGCTCGACCAGCCGTGTGAGTTGATGGTGTGGTATGAAGGCGTACTCCAA
CGGCGAGTGAGCGGCATTATCAGTGCCTTCGCGCAGGGTGACACCGGCTTTCGCCGCACGCGCTATCAGG
CAGAGGTTCGCCCGGCACTGTGGCGGTTGGGACTGCGTACCAATGCCCGTATCTTTCAGGCGCAAAAGCC
GGAGGCCATTATCGGGACGTTGCTGGAAGAGTCTGGTATTACCGATTATGCCTTTGCGCTACGTCACGAC
CACGCCCCGCGCGAATACTGCGTACAGTATCGCGAAAGTGATTTGGCGTTTGTCACCCGTCTGGCCGCAG
AGGAAGGTCTGTACTTCTTCCATGAGTTTGAAGAAGGTAAGCACCGCGTCGTCTTTGCCGATGATGCCGG
AGCGCTCAGCAAAGGCCCGGAACTGTTCTTCAACCTCGCCACGCAGGGACTGAGCGAAGGCGAATACGTC
CGCCGTTTCCGCTACGCCGAAGCCGTCAGTACCGCAGAAGTCGCCCTCAAAGACTACAGCTTCAAAACGC
CCGCGTATGGCCTGCTGCACAGCAAAATAAGCGGAGAGCTGGCGCACCAGCGTGAAAGCTACCAGCACTA
TGACTACCCCGGGCGTTTTAAACAAGACCCAAGCGGCAAGGCCTTTACCGGCTACCGGCTGGATGCGTTA
AGAGCGGGAGCGATGACCGGCTCCGGTGAATCCAATGCCGCGATGTTGATGCCCGGCAGCAGCTTTACCT
TAACCGAACACCCCAACCCGACGCTGAATAGTGGCTGGCAGTTGGTTGCCATCACCCACAGCGGGCAGCA
GCCGCAGGCGCTGGAAGAAGAAAGCGGCGGTGAACCGACCACCTACAGCAACAGCTTCGAGGTTATCAGT
GCCAAAAGCACCTGGCGTGCCGACCTGCCGTACAAACCGATGGTCGATGGCCCGCAAATCGCCACCGTGG
TCGGCCCCGCCGGTGAGGAAATCTACTGCGATGAATATGGCCGTATCAAACTGCAATTCCCGTGGGACAG
GTATGGCTCCAGTGACGACCAGAGCTCCTGCTGGGTGCGGGTCAGTCAGGGCTGGGCCGGTGGTCAGTAT
GGCCTGATAGCCATCCCGCGCATCGGCCATGAGGTGATTGTCAGTTTTCTGGAAGGCGACCCGGATCAGC
CGATTGTCACCGGCAGAACCTTTCATGCCACCAACCCGGCACCGTATCCGCTGCCCGCCAACAAGACGCG
CACCTCAATCCGCACATCAACCCACAAAGGCGCGGGGTTCAACGAACTGCGCTTTGAAGATCAGGCTGGG
CAGGAAGAAGTGTTTATTCATGCCCAGAAAGACATGAACACCGTGGTGCTGAATAATCGCACAACCAGCG
TGACCGCTGACCACACTGAAAGCGTCGGTGGCAATCAGGCGGTATCGGTGGTGAAAGACCAGTCCACTGA
AATCCAGGGGCAGCAGAGTATCGCCGTGACCAAAAACCGCAACACGGTCGTGGATGACAACGACAGCCTT
CAGGTGAAAAACAACATCGCTATCCAGTCGCAGAAGGGGGACATCCTGATAGCGACTGACAAGGGGTTTA
TTGGTATCGGCGCGGACGGGGTCATCAACATCAAGGGTACCCACATTGTCATCAACGGCCAGCAAATCGA
CCTGAACTGA