SecReT6
Effector Protein ID: 261819975
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_0650
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]689957..694225 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorDda3937_02773
DescriptionRhsB
UniProt IDD0KGU0
KEGG IDpwa:Pecwa_0650
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 466..493
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 486..513
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 559..585
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 592..627
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 612..647
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 654..677
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 676..713
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 741..778
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 766..799
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 810..841
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 847..876
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 887..916
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 948..963
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 978..988
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 1008..1044
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 1029..1064
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 1072..1091
RHS_repeat [PF05593], Evalue: 1.70E-50, Aligned region: 1109..1137
AHH [PF14412], Evalue: 1.10E-21, Aligned region: 1306..1410
PAAR_motif [PF05488], Evalue: 7.80E-18, Aligned region: 113..179
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 505..548
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 588..634
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 649..678
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 689..718
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 775..837
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 831..898
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 865..948
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 979..1085
DUF4595 [PF15283], Evalue: 2.90E-05, Aligned region: 1076..1122
DUF4150 [PF13665], Evalue: 0.00037, Aligned region: 114..134
DUF4150 [PF13665], Evalue: 0.00037, Aligned region: 139..172
RHS [PF03527], Evalue: 0.005, Aligned region: 568..581
RHS [PF03527], Evalue: 0.005, Aligned region: 603..614
RHS [PF03527], Evalue: 0.005, Aligned region: 632..646
RHS [PF03527], Evalue: 0.005, Aligned region: 1202..1220
Protein Sequence: 1422 a.a.     [Download]
>gi|261819975|ref|YP_003258081.1| hypothetical protein Pecwa_0650 [Pectobacterium wasabiae WPP163]
MRDDILARIARVGAMHAGNRPTLPPDLPAPGSGSPPTSPGKPIKHSSFLGALLGAVAGALVAAAVAAVAV
ALVGVTGGLAIALVGGLAVLGAGSLISAVSGRVSAMVDSASPPAGKVDSGSPNVSVEGSPVSRAEVDVVL
CTKHNGPQLIAQGSETVFVNGHPAARIGDKTVCGATIKDGAATVFFGSGQATVLEIQDEFSGWQKALLIA
VEFLVPPTRGLFRGLGKLFFRGPKAVMKGLGAGALWAGKRFTQKTRCATRAFKANKGRARVTQAAKAFKK
DPVYIASGEVIESRTDIELGQTLPLLFERTYRSASSRGGLAGRGWQDSWSEVATLSDDNGDTHVTITLAQ
GYDIDFTFGIGATVVYCAEYPEFKLVKRHNGFHLWHRDSQTWRAFTVRQGDRLRLSAITDNHQNRIDFLR
DPKGYLRKVRHSDGIELLLVWQGKFLRQVQRIDGGQKTVLAEYRQDEQGRLVEADAAHAYHLFYDYDNQN
RLIRWHDNDKTWARYEYDHQGRCVYTTCADGYLTANFEYLSDRVVMTDGLGQRHEYGFNALYLMAWEKSP
LGHVTRYEYDEVGNLLREISPAGRVVEFAYLDDTGLVSTFTDGSGHAWQYAYDDHERLIGITDPLGRNWA
WQYDSKGNPLSLTGPDASEVRFAWNRYGLLTEVSDQNGQVQASLYYDHRQRLLSATDAESRTQQLRYDQQ
DRLTTWTRPDGSTYRLGYRRASWKLPEQLLRPDDKQEQRQYDKHNNLLNYTDGNGAVWAQTYGPFDLLTS
RTDAAGRTWQYEYDKESQQLVCVTAPDGNQWQWWLDADARVIRERDMAGTETHYGYDEDGHSITVRNGEG
EIRHFLYDGRGLLIKETAPDDTLHYRYDAAGRLIEVASSTSHIQLAYDERDRVVLERNSGTVIRRDYQNA
TREVTRTLLWDEDKDGDDTALTSIFRYRATGELHQVQLPDGAELTLAHDAAGRESSRQSQAGFMQHREYD
AMGWLTREMSGQTVDGRLQPVQTREYLYDGAGNLTGTRRNREAAGYQLDASGRVLSVLSGGAGRTVETEE
QYRYTRSGLPQDATRLTEWQAGRLTQQDNTHYQYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDT
PAGERWFYRYDPFGRRIGKRCEQTQDELRYLWDSDQIADVRHHRNNQLISRRHWVHNGWELLVQQRQNTD
GSWETDFVTSGHNGEPQAIFNKQGDLRWQAPRTNLWGQRYTDNTESLDPGLAFAGQYRDVESSLCYNRFR
YYDPSGGCYISPDPISILGGENNYGYVQNPLDWVDPFGLTSCELAKKMENAGTPRPVNSAAHHIVGETSK
GAKPARDILNKHKIDINGSDNGVFLPNRNNTDGLAGILHNGRHPDDYLAAVNRRIELADILGGKSEVVKE
LGRIRDILSSANRNASWSTVLL
-
Nucleotide Sequence: 4269 bp     [Download]
>gi|261819370|ref|NC_013421.1|:689957-694225 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCGTGATGACATTCTGGCGCGTATTGCGCGTGTCGGTGCCATGCACGCGGGCAACCGGCCCACGTTAC
CGCCTGATTTACCGGCACCCGGCAGCGGCTCGCCGCCGACCTCACCGGGTAAACCCATCAAACACAGCAG
TTTCCTGGGGGCACTGCTCGGTGCCGTGGCTGGGGCTCTGGTAGCAGCAGCGGTCGCGGCCGTGGCCGTT
GCCCTGGTGGGCGTCACCGGTGGACTGGCGATTGCACTGGTCGGTGGGCTGGCGGTACTGGGAGCGGGAA
GCCTGATATCGGCGGTCAGTGGTCGGGTATCCGCCATGGTGGACAGTGCCTCACCGCCGGCGGGGAAAGT
GGACAGTGGTTCACCGAATGTGTCGGTGGAAGGGAGTCCGGTTTCCCGTGCCGAAGTCGATGTCGTTCTC
TGCACCAAACACAACGGTCCGCAACTGATTGCGCAGGGCAGTGAAACTGTCTTCGTGAACGGTCATCCGG
CGGCGCGGATAGGCGATAAAACCGTGTGTGGTGCCACTATCAAGGACGGGGCAGCAACGGTGTTCTTTGG
TTCCGGTCAGGCTACCGTACTGGAGATACAGGATGAATTCAGCGGCTGGCAAAAAGCGCTGCTGATTGCG
GTGGAATTTCTGGTGCCGCCGACCCGTGGCCTGTTTCGCGGGTTGGGGAAGTTATTCTTTCGCGGCCCCA
AAGCGGTGATGAAAGGGCTGGGGGCTGGCGCACTCTGGGCAGGAAAACGGTTTACGCAAAAGACCCGCTG
CGCCACCCGCGCCTTTAAGGCGAACAAGGGTCGGGCACGGGTGACGCAAGCGGCCAAAGCCTTCAAGAAA
GACCCGGTGTATATCGCCAGCGGTGAAGTAATTGAAAGCCGCACCGATATCGAGCTGGGCCAGACTCTCC
CGCTGCTGTTCGAGCGTACCTATCGCTCCGCTTCTTCACGGGGCGGATTAGCAGGCCGTGGCTGGCAGGA
TAGCTGGAGCGAAGTCGCGACCCTCAGCGACGATAACGGCGACACCCATGTCACTATCACTCTGGCGCAG
GGTTATGACATTGATTTCACCTTCGGGATAGGGGCCACCGTGGTGTACTGCGCCGAGTACCCCGAATTCA
AACTGGTGAAACGCCATAATGGCTTTCACCTGTGGCACCGCGACAGCCAGACCTGGCGGGCCTTTACCGT
CAGACAGGGTGACCGGCTACGGCTGTCTGCCATTACCGACAACCACCAGAACCGTATCGACTTTCTCCGT
GACCCCAAAGGCTACCTGCGTAAGGTGCGGCACAGCGACGGCATCGAGCTGCTGCTGGTGTGGCAGGGGA
AGTTTCTGCGTCAGGTACAGCGCATTGATGGCGGTCAGAAAACCGTACTGGCCGAATACCGGCAGGATGA
ACAAGGCCGACTGGTCGAGGCGGATGCGGCCCATGCCTATCACCTGTTTTATGACTACGACAATCAAAAC
CGCCTCATTCGCTGGCACGACAACGACAAAACCTGGGCACGGTATGAGTATGACCATCAGGGCCGGTGCG
TTTACACCACCTGTGCCGACGGCTACCTGACGGCGAATTTCGAGTACCTGTCCGACCGCGTGGTGATGAC
CGACGGGCTGGGTCAGCGCCATGAATACGGCTTCAATGCCCTGTACCTGATGGCCTGGGAGAAATCCCCG
CTCGGCCATGTCACCCGTTATGAATACGATGAGGTCGGCAACCTGCTGCGGGAAATCTCTCCGGCAGGGC
GAGTCGTAGAATTTGCCTATCTGGATGATACCGGACTGGTCAGCACCTTCACCGACGGCAGCGGCCACGC
GTGGCAGTACGCCTATGACGACCATGAACGGCTTATCGGTATTACCGACCCGCTCGGGCGTAACTGGGCC
TGGCAGTACGACAGCAAGGGCAATCCGTTGAGCCTGACCGGGCCGGACGCCAGTGAAGTCCGGTTTGCGT
GGAACCGCTACGGCCTGCTGACCGAAGTCAGCGACCAGAACGGCCAGGTACAGGCCAGCCTGTATTACGA
CCATCGCCAGCGCCTGTTAAGTGCCACCGATGCGGAGTCCCGCACCCAGCAACTGCGCTACGACCAGCAG
GACCGGCTGACCACCTGGACACGCCCGGATGGCTCCACTTATCGGCTGGGCTATCGCCGTGCAAGCTGGA
AGCTGCCGGAGCAGCTGCTGCGCCCCGACGACAAACAAGAGCAGCGCCAGTACGACAAGCACAACAACCT
GCTGAACTATACCGACGGCAACGGCGCAGTATGGGCACAAACCTACGGCCCGTTTGACTTGTTAACCTCC
CGTACCGATGCGGCAGGCCGTACCTGGCAGTACGAGTATGACAAAGAAAGTCAGCAACTGGTGTGCGTCA
CGGCACCGGACGGTAACCAGTGGCAATGGTGGCTGGATGCGGATGCGCGGGTTATCCGCGAACGGGACAT
GGCGGGTACGGAGACCCACTACGGCTATGACGAAGACGGCCACTCCATCACTGTTCGTAACGGCGAAGGG
GAAATCCGCCACTTCCTGTACGACGGGCGTGGATTACTGATAAAAGAAACCGCGCCGGACGATACCTTGC
ACTACCGCTACGATGCGGCAGGCAGGCTGATCGAAGTGGCATCCTCCACCAGTCATATCCAGCTGGCGTA
TGACGAGCGTGACCGTGTGGTACTTGAGCGGAACAGTGGCACAGTCATCCGCCGTGATTATCAGAACGCT
ACACGTGAGGTCACCCGTACCCTGCTTTGGGATGAGGATAAGGACGGCGACGACACGGCACTCACCAGCA
TTTTCCGCTACCGCGCCACAGGTGAACTGCATCAGGTGCAGTTACCGGATGGCGCGGAACTGACGCTGGC
TCACGATGCTGCGGGGCGTGAGTCTTCCCGCCAAAGTCAGGCGGGCTTTATGCAGCACCGTGAATACGAC
GCCATGGGCTGGCTGACGCGGGAAATGAGCGGCCAGACGGTGGACGGTCGCCTGCAGCCTGTGCAGACCC
GTGAATACCTCTACGACGGCGCAGGCAACCTGACCGGCACTCGGCGCAATCGCGAAGCGGCAGGCTATCA
ACTCGATGCCAGCGGACGGGTACTGTCAGTACTGAGCGGCGGCGCGGGGCGCACCGTCGAAACCGAAGAG
CAATACCGCTATACCCGCAGCGGTTTGCCGCAGGATGCGACAAGGCTGACCGAATGGCAGGCCGGACGCC
TGACTCAGCAGGACAACACTCACTATCAATATGACAAGGCCGGGCGGCTCATTCGCAAACAGGTGGTGCA
GCCGGGCTATCGGCCGCAGGTGTGGCACTACCGTTGGGACAGTCGCAACCAGCTCCGAGTGGTGGATACG
CCAGCAGGTGAACGCTGGTTCTACCGCTACGACCCGTTCGGACGGCGCATCGGCAAGCGCTGTGAGCAAA
CGCAGGATGAACTCCGCTACCTGTGGGATAGCGACCAGATTGCCGACGTGCGTCACCACCGCAACAACCA
GCTTATCAGCCGCCGCCACTGGGTACATAACGGCTGGGAGCTGCTGGTACAGCAACGCCAAAATACAGAC
GGCAGTTGGGAAACGGACTTTGTGACCAGCGGCCATAACGGCGAACCGCAGGCCATATTTAACAAGCAAG
GTGATCTGCGCTGGCAGGCTCCACGCACCAATTTATGGGGGCAGCGCTATACAGATAATACTGAAAGTCT
TGATCCAGGACTGGCCTTTGCCGGGCAATACCGTGACGTTGAAAGCAGCCTATGCTATAACAGATTCCGC
TATTATGATCCGAGTGGTGGTTGTTATATCTCGCCAGACCCGATCAGTATTTTGGGTGGTGAGAATAACT
ATGGATATGTGCAGAATCCGCTGGATTGGGTTGATCCGTTTGGGTTAACTAGTTGTGAACTAGCGAAAAA
AATGGAGAATGCGGGGACACCTAGGCCAGTGAATTCGGCGGCACACCATATTGTAGGCGAAACGTCTAAA
GGCGCTAAGCCTGCTAGGGATATATTGAATAAACATAAAATAGATATAAATGGCTCTGATAATGGAGTCT
TTCTGCCAAATAGAAATAATACAGATGGGCTAGCAGGGATACTACATAATGGTAGGCATCCAGACGACTA
TCTAGCTGCGGTAAATAGAAGGATTGAGTTGGCTGATATTTTAGGTGGGAAGTCAGAGGTCGTTAAAGAG
TTGGGTAGGATTAGAGATATTCTTTCTTCTGCTAATAGAAATGCAAGCTGGAGTACAGTATTGTTATGA