SecReT6
Effector Protein ID: 261820897
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_1606
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1741995..1742513 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDD0KGG1
KEGG IDpwa:Pecwa_2697, pwa:Pecwa_1606
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|261820897|ref|YP_003259003.1| type VI secretion system effector [Pectobacterium wasabiae WPP163]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDATIVDINCQMPHCQDPSKLDYTQ
LIEVSLAYRKVDWEHTVAGTSGSDDWRTPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1741995-1742513 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGAAAAACGCAGGGCAACATCACCGCTGGAGCCTTCACGT
CTGATTCTGTCGGCAACATCTACGTGGAAGGCCACGAAGATGAAATGCTGGTACAGGAATTCAAACACGT
CGTCACCGTACCGACCGACCCACAGTCAGGTCAGCCCTCCGGCCAGCGCGTCCATAAGCCGTTCAAGTTC
ACCGTTGCGCTGAACAAGGCCGTGCCGCTGATGTACAACGCCTTGGCCTCCGGTGAAATGCTGCCGACCG
TGACCCTGAAGTGGTATCGCACCTCAGTGGAAGGCAAGCAAGAGCACTTCTTCTCTACTGTGCTGACTGA
CGCCACTATCGTTGACATCAACTGCCAGATGCCACATTGCCAGGACCCTTCCAAGCTCGATTACACCCAG
TTGATCGAAGTCTCTCTGGCCTACCGCAAGGTTGACTGGGAGCACACGGTTGCCGGTACGTCCGGCTCTG
ATGACTGGCGCACGCCTGTCGAAGCCTGA