SecReT6
Effector Protein ID: 261820898
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_1607
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1742607..1744457 [+]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDD0KM36
KEGG IDpwa:Pecwa_1607
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-68, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.80E-22, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 0.0027, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 0.0027, Aligned region: 509..530
Gp5_C [PF06715], Evalue: 0.0027, Aligned region: 516..538
Gp5_C [PF06715], Evalue: 0.0027, Aligned region: 552..559
Gp5_C [PF06715], Evalue: 0.0027, Aligned region: 605..611
Protein Sequence: 616 a.a.     [Download]
>gi|261820898|ref|YP_003259004.1| ImpA family type VI secretion-associated protein [Pectobacterium wasabiae WPP163]
MANSTGLQFTVKVGALPESTFAVVDFQLSEALNQPFALSLNLASPLPGVDFGAVLDQPCELRVWYEGELK
RRVSGIISAFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEDIIGALLEESGITDYAFALRHE
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEAGKHRVVFADDAGALSKGPELFFNLATQGLSEGEYV
RRFRYAEAVSTAEVALKDYSFKTPAYGLLHSKVSGELEHQRETYQHFDYPGRFKQDPSGKAFTGYRLDAL
RAGAMTGSGESNAAMLMPGSSFTLTEHPNPTLNAAWQLVAITHSGQQPQALEEESGGEPTTYSNSFEVIS
AKSTWRAGLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTSTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRSTTVTADHTENVGGNQTVSVIKDQSTEIQGQQTIAISGSRSTVVGDVTAT
EEIHDSLQVKNNILIQSMQGSILIAANIGFISISDEGDITIKGKTVTINGNRIDLN
-
Nucleotide Sequence: 1851 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1742607-1744457 Pectobacterium wasabiae WPP163 chromosome, complete genome
GTGGCAAACAGTACAGGATTACAGTTCACGGTAAAGGTCGGTGCCTTGCCCGAAAGCACCTTTGCGGTGG
TGGATTTTCAGCTCAGCGAGGCCCTGAACCAGCCGTTTGCCCTGTCGCTGAATCTGGCCAGCCCGTTACC
GGGCGTCGACTTTGGCGCGGTACTCGATCAGCCCTGTGAACTGCGGGTGTGGTATGAGGGGGAACTCAAA
CGCCGGGTCAGTGGCATCATCAGCGCCTTTGCCCAGGGTGATACGGGCTTTCGTCGTACCCGCTATCAGG
CAGAGGTTCGCCCGGCATTGTGGCGGCTGGGGCTGCGCACCAATGCCCGCATTTTTCAGGCACAAAAGCC
CGAGGACATTATTGGTGCGTTGCTGGAAGAGTCCGGTATTACCGATTACGCCTTTGCGCTGCGTCATGAG
CACGCGCCCCGTGAATACTGTGTGCAGTATCGGGAAAGCGATTTGGCCTTTGTCACCCGACTGGCAGCGG
AAGAAGGCCTGTACTTCTTCCACGAGTTTGAGGCTGGCAAGCACCGGGTGGTCTTTGCGGATGATGCCGG
GGCGCTCAGTAAAGGCCCGGAACTGTTCTTCAACCTTGCCACGCAGGGTCTGAGCGAAGGCGAATACGTC
CGCCGCTTTCGCTATGCCGAAGCGGTCAGCACCGCCGAGGTTGCTCTCAAGGACTACAGCTTTAAAACCC
CGGCCTACGGTCTGCTGCACAGCAAGGTGAGCGGTGAGCTGGAACACCAGCGCGAGACCTACCAGCATTT
CGACTATCCGGGCCGCTTCAAACAAGATCCGAGCGGCAAGGCCTTTACTGGCTATCGGCTGGATGCACTG
CGGGCGGGTGCGATGACTGGCTCGGGTGAATCCAACGCCGCGATGCTGATGCCGGGCAGTAGCTTTACCC
TGACTGAACACCCCAATCCAACGCTCAACGCTGCCTGGCAACTGGTGGCCATCACGCATAGCGGACAACA
GCCGCAGGCACTGGAAGAAGAGAGCGGCGGCGAACCGACCACCTACAGCAACAGTTTCGAGGTGATCAGT
GCCAAATCAACCTGGCGTGCCGGTCTGCCGTACAAGCCGATGGTCGATGGCCCGCAAATCGCCACTGTCG
TCGGCCCGGCTGGGGAGGAAATCTACTGCGACGAATACGGGCGCATCAAACTGCAATTCCCGTGGGACAG
ATACGGGGCCAGCGATGACCAGAGCTCCTGCTGGGTGCGCGTCAGCCAGGGCTGGGCCGGCGGTCAGTAC
GGCCTGATTGCCATCCCGCGTATCGGCCATGAGGTCATCGTCAGTTTCCTGGAAGGCGACCCGGACCAGC
CGATTGTGACGGGCCGTACCTTCCATGCCACCAATCCGTCGCCGTACCCACTGCCCGCGAACAAGACACG
CACCTCGCTGCGAACTTCAACGCATAAGGGAGCGGGCTTCAATGAACTGCGCTTTGAAGACCAGGCCGGG
CAGGAAGAAGTGTTTATCCATGCTCAGAAAGACATGAACACCGTGGTGCTGAACAACCGCAGTACCACGG
TGACCGCTGACCATACCGAAAACGTTGGCGGCAATCAGACGGTGTCGGTCATCAAAGACCAGTCCACCGA
AATCCAGGGGCAGCAAACCATTGCCATCTCCGGTAGCCGCAGCACGGTGGTGGGCGATGTCACAGCAACA
GAAGAAATTCACGACAGCCTGCAGGTGAAAAACAACATCCTTATCCAATCGATGCAGGGCAGCATTCTGA
TTGCCGCCAACATCGGTTTTATCAGTATCAGCGACGAAGGTGACATCACCATCAAGGGCAAAACCGTCAC
CATCAACGGCAATCGTATCGACCTGAACTGA