SecReT6
Effector Protein ID: 261820900
-
SecReT6 ID368
T6SS typeA1
Gene symbol-
Locus tagPecwa_1609
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1744928..1749271 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorDda3937_01758
DescriptionRhsA
UniProt IDD0KM38
KEGG IDpwa:Pecwa_1609
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 482..490
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 502..529
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 575..601
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 611..643
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 628..663
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 649..686
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 692..729
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 757..779
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 782..815
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 826..858
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 863..894
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 883..915
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 903..923
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 951..977
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 992..1002
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 993..1032
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 1022..1052
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 1086..1105
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 1123..1151
PAAR_motif [PF05488], Evalue: 8.10E-16, Aligned region: 9..22
PAAR_motif [PF05488], Evalue: 8.10E-16, Aligned region: 128..193
DUF4595 [PF15283], Evalue: 3.00E-06, Aligned region: 521..565
DUF4595 [PF15283], Evalue: 3.00E-06, Aligned region: 604..650
DUF4595 [PF15283], Evalue: 3.00E-06, Aligned region: 790..849
DUF4595 [PF15283], Evalue: 3.00E-06, Aligned region: 876..913
DUF4595 [PF15283], Evalue: 3.00E-06, Aligned region: 881..964
DUF4595 [PF15283], Evalue: 3.00E-06, Aligned region: 993..1099
DUF4595 [PF15283], Evalue: 3.00E-06, Aligned region: 1090..1145
DUF4150 [PF13665], Evalue: 0.0034, Aligned region: 132..149
DUF4150 [PF13665], Evalue: 0.0034, Aligned region: 153..187
Protein Sequence: 1447 a.a.     [Download]
>gi|261820900|ref|YP_003259006.1| hypothetical protein Pecwa_1609 [Pectobacterium wasabiae WPP163]
MREEILSRIARVGAMHAGNRPKPPPDLPEPGQGKPPTSPGKAIKHSSFWGALAGAAVGALIAAAAFTVAA
AAVAGAVALTGITGGAGLALVVGVVKLAVGFGAVFALGDLIGGVTNRVSAMVDSASPSSGAVKDGSKTVF
VEGNPVSRAEIDAVLCDKHSGPQLIAQGSATVFVEGYYAARVGDKTVCGATIKEGASTVFFGSGQESPLS
VADEFSGWEKALILAVEFLMPPSRGLFRGLGKLFTKGPMAVLRGMKAGAAHALEGLRSAVQCAKNGFKES
KGLARVTESIRGFLKDPVYIASGEVIEKRLDLELGQTVPLLFERTYRSGSPHSGLLGHGWHDSWSEVATV
GRTEQGDIQVTLTLAQGYDIDFTFVVGATVVYCAEYPEFKLVKRHNGFHLWHRDSQTWRAFTAKQGDQLL
LSAITDNHRNRIDFLRDPKGYLRKIRHSDGIELLLVWQGEFLRQVQRIDGGQKTVLAEYRQDEQGRLVEA
DAAHAYHLFYDYDSHHRLIRWHDNDQTWARYEYDPQGRCVYTTCADGYLTANFEYLADRVVMIDGLGQRH
EYGFNDLYLMAWEKSPLGHITHYEYDDVGNLLREISPAGRVVEFAYLDNSGLVSTFTDGSGHQWHYDYDH
YERLIGITDPLGRSWAWQYDSKGNPLSLTGPDASEVRFAWNRYGLLTEVSDEQGRTQASLFYDHRHRLMS
ATDAESRTRQLRYDQQDRLTSWTRPDGATYRLGYRRASWKLPEQLLRPDDKQEQRQYDKHNNLLNYTDGN
GAVWAQTYGPFDLLTSRTDAEGRTWQYEYDKESQQLVCVTAPDGNRWQWWLDADARVIRERDMAGTETHY
GYDEDGHCIAVRNGEGETRHFLYDGRGLLIKETAPDDTLHYRYDAAGRLIEVTSSTSHIQLEYDERDRVV
QERNSGTAIRRHYQDTSHTVTRSLHWEGEEDSAALTSTFRYSATGELRQVQLPDGAELTLAHDSAGRESS
RQSQAGFMQHREYDAMGWLTREMSGQAVDGRLQPTQTREYLYDGAGNLTGTRRNREAAGYQLDASGRVLS
VLSGGAGRSVNTEEQYRYTRSGLPQDATRLTEWQAGRLTQQDNTHYQYDKAGRLIRKQVVQPGYRPQVWH
YRWDSRNQLRVVDTPAGERWFYRYDPFGRRIGKRCDQTHEDIRYLWDGDQIAEVRHYRDDELVSRRHWIH
NGWELLVQQRQNADGRWETDFMTSSHNGEPQAAFNLAGELRWQAPRTNLWGQRYTDNTENLDPGLAFAGQ
YRDAESSLCYNRFRYYDPNGGYYISPDPVSIFGGDVNYGYAHNPLGWVDPFGLASCEHLNRMAKEVHDLA
GGLKTPDTRAIRNSTVSIVEATVDGKKVLYAAGSGGRLNPRQVETLERLGVSRENIFKGARVTNEFSKLE
NHAERIILRNLPEGAVVNRWGISWGGLQRGIPCDHCAPFVRDAGGFF
-
Nucleotide Sequence: 4344 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1744928-1749271 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCGTGAGGAAATTCTCTCCCGCATTGCGCGGGTAGGGGCGATGCACGCGGGTAACCGTCCTAAACCGC
CGCCGGATTTACCTGAACCGGGTCAGGGTAAACCGCCTACCTCGCCGGGCAAGGCCATCAAGCACAGCAG
CTTCTGGGGCGCACTGGCCGGCGCGGCTGTCGGGGCGTTAATTGCTGCTGCCGCGTTTACCGTGGCGGCA
GCAGCCGTCGCGGGTGCCGTGGCCCTGACCGGCATCACCGGCGGGGCCGGTCTGGCTCTGGTGGTGGGGG
TCGTCAAGCTTGCAGTCGGATTTGGTGCCGTGTTTGCGCTGGGTGACCTGATAGGCGGCGTCACTAACCG
GGTCTCGGCCATGGTGGACAGCGCCTCGCCTTCATCGGGGGCGGTCAAGGATGGCTCAAAGACCGTCTTT
GTCGAAGGCAATCCGGTCTCGCGCGCTGAAATCGATGCGGTGCTGTGCGACAAACACAGCGGCCCGCAAC
TGATTGCCCAGGGCAGTGCCACGGTATTTGTCGAGGGCTACTATGCGGCGCGGGTGGGGGACAAAACCGT
CTGTGGAGCCACGATCAAGGAAGGCGCTTCGACGGTGTTCTTTGGTTCAGGCCAGGAATCGCCTCTCTCG
GTAGCGGACGAGTTCAGCGGCTGGGAAAAAGCGCTGATACTCGCGGTGGAATTCCTGATGCCCCCTAGTC
GCGGTCTGTTCCGGGGACTGGGCAAGCTGTTTACCAAAGGGCCGATGGCGGTGCTGCGGGGCATGAAAGC
GGGAGCAGCACATGCCCTGGAAGGGCTCCGTAGCGCCGTGCAGTGCGCGAAAAACGGCTTTAAAGAAAGC
AAAGGACTGGCGCGTGTCACCGAATCCATTCGCGGCTTCCTGAAAGACCCCGTCTACATCGCTAGTGGTG
AGGTCATTGAAAAACGCCTCGATCTGGAGCTGGGCCAGACCGTTCCGCTGCTATTCGAGCGCACCTACCG
CTCCGGTAGCCCTCACTCCGGCCTGCTGGGGCATGGCTGGCACGATAGCTGGAGTGAGGTGGCCACAGTG
GGTCGCACCGAGCAGGGTGACATCCAGGTGACGCTCACCCTGGCACAGGGCTACGACATCGACTTCACCT
TCGTGGTCGGTGCGACCGTGGTGTACTGCGCCGAATACCCAGAATTCAAACTGGTGAAACGCCATAACGG
CTTTCACCTGTGGCACCGCGACAGCCAGACCTGGCGGGCGTTTACCGCCAAGCAGGGAGACCAGCTACTG
CTGTCGGCTATCACCGACAACCACCGCAACCGCATCGACTTTCTGCGCGATCCGAAAGGCTACCTGCGCA
AGATCAGACACAGTGACGGCATAGAACTGCTGCTGGTGTGGCAGGGCGAGTTCCTGCGCCAGGTACAGCG
CATTGACGGTGGCCAGAAAACGGTGCTGGCCGAATACCGGCAGGATGAACAGGGACGGCTTGTCGAGGCC
GACGCCGCCCATGCCTACCACCTGTTCTACGACTACGACAGCCATCACCGTCTGATCCGCTGGCACGACA
ACGACCAGACCTGGGCACGGTATGAATACGACCCTCAGGGGCGCTGCGTTTATACCACCTGTGCCGATGG
CTACCTGACGGCTAATTTTGAGTACCTGGCCGACCGCGTGGTGATGATTGACGGGCTGGGGCAACGCCAT
GAATACGGCTTCAACGACCTGTACCTGATGGCCTGGGAGAAATCCCCGCTTGGCCATATCACCCATTACG
AATACGACGACGTAGGCAACCTGCTGCGGGAAATCTCTCCGGCAGGGCGGGTCGTGGAATTTGCCTATCT
GGACAACAGCGGACTGGTCAGCACCTTTACCGACGGCAGCGGCCATCAGTGGCACTACGACTATGACCAC
TACGAGCGGCTGATCGGCATCACCGACCCATTAGGTCGCAGTTGGGCATGGCAGTACGACAGCAAGGGCA
ATCCGCTGAGCCTGACCGGGCCGGACGCCAGCGAAGTCCGGTTTGCGTGGAATCGCTACGGCCTGCTGAC
CGAGGTGAGTGATGAACAAGGCCGGACGCAGGCCAGCCTGTTTTATGACCACCGGCACCGCCTGATGAGT
GCCACTGATGCGGAATCCCGCACCCGGCAACTGCGCTATGACCAGCAAGACCGCCTTACAAGCTGGACAC
GCCCGGATGGTGCCACCTATCGCCTAGGGTATCGCCGTGCCAGTTGGAAACTGCCGGAACAACTGCTGCG
CCCGGACGATAAGCAAGAGCAACGCCAGTACGACAAACACAACAACCTGCTGAACTACACCGACGGTAAC
GGCGCGGTATGGGCACAAACCTACGGCCCGTTCGACCTGCTGACTTCACGCACCGACGCTGAAGGCCGTA
CCTGGCAGTACGAATATGATAAAGAAAGCCAGCAACTGGTGTGCGTCACCGCACCGGATGGCAACCGCTG
GCAATGGTGGTTGGATGCCGATGCACGGGTTATCCGTGAGCGGGACATGGCGGGGACGGAAACCCATTAC
GGCTACGATGAGGACGGACATTGCATCGCGGTTCGTAACGGCGAAGGAGAAACCCGCCACTTTCTGTACG
ACGGGCGCGGCCTGCTTATCAAAGAAACCGCGCCGGACGACACCCTGCACTACCGCTACGATGCGGCAGG
CAGGCTGATCGAAGTGACATCCTCCACCAGTCATATCCAGCTTGAATATGACGAGCGTGACCGGGTGGTA
CAGGAGCGGAACAGCGGCACGGCAATCCGACGCCACTATCAGGACACGTCGCATACCGTCACCCGCAGCC
TGCACTGGGAGGGCGAAGAAGACAGTGCGGCACTCACCAGCACCTTCCGTTACAGTGCGACAGGTGAACT
GCGTCAGGTGCAGTTACCGGATGGCGCGGAGCTGACGCTGGCGCACGACAGTGCGGGTCGGGAGTCTTCC
CGGCAGAGTCAGGCTGGCTTTATGCAGCACCGTGAATACGATGCCATGGGCTGGCTGACGCGGGAGATGA
GCGGCCAGGCGGTGGACGGTCGCCTGCAACCGACCCAGACGCGGGAATACCTCTACGACGGCGCAGGCAA
CCTGACCGGCACCCGACGCAACCGTGAAGCAGCAGGCTATCAACTCGATGCCAGCGGACGGGTGCTGTCG
GTACTGAGCGGCGGTGCGGGGCGCAGCGTAAACACCGAAGAACAATACCGCTACACCCGTAGCGGCTTAC
CACAGGACGCGACCCGCCTGACCGAATGGCAGGCCGGACGCCTGACCCAGCAGGACAACACTCACTATCA
GTATGACAAGGCCGGACGTCTCATCCGCAAGCAGGTGGTGCAGCCGGGCTATCGGCCGCAGGTGTGGCAC
TACCGTTGGGACAGCCGCAACCAGCTCAGGGTTGTGGATACGCCAGCAGGTGAACGCTGGTTCTACCGTT
ACGACCCGTTCGGACGGCGCATTGGCAAACGTTGCGACCAAACCCATGAAGACATCCGCTATCTATGGGA
TGGGGACCAGATAGCCGAAGTACGGCACTATCGTGACGATGAATTGGTATCGCGTCGGCACTGGATACAC
AACGGCTGGGAACTGCTGGTACAGCAACGGCAGAACGCCGATGGTCGTTGGGAAACCGATTTTATGACTA
GCAGCCATAATGGTGAACCGCAGGCAGCTTTTAATCTGGCTGGTGAGCTTCGCTGGCAGGCTCCCCGCAC
CAACTTATGGGGGCAGCGCTATACAGATAATACTGAAAACCTTGATCCAGGGCTGGCGTTTGCCGGGCAG
TACCGTGACGCGGAAAGTAGCTTATGCTATAACAGGTTCCGCTATTATGATCCGAATGGTGGTTATTATA
TCTCGCCTGACCCTGTGAGTATTTTCGGGGGAGATGTTAATTACGGATATGCACATAACCCGCTTGGTTG
GGTGGATCCGTTTGGGCTTGCTTCCTGTGAACACTTAAACAGAATGGCAAAGGAAGTTCATGATCTTGCT
GGAGGTCTAAAAACCCCAGACACCCGGGCCATTAGAAACTCAACAGTTTCAATTGTTGAGGCTACTGTAG
ACGGTAAAAAAGTTTTATATGCAGCTGGTAGTGGTGGCCGTCTTAATCCAAGGCAAGTGGAAACTCTAGA
GAGGTTAGGTGTATCTAGGGAAAATATTTTCAAAGGGGCTCGAGTAACAAATGAATTTTCAAAACTGGAG
AATCATGCTGAAAGAATAATATTAAGAAATCTTCCTGAAGGCGCTGTTGTTAATAGGTGGGGAATATCGT
GGGGTGGTTTGCAAAGAGGAATACCTTGCGACCATTGTGCTCCATTTGTGCGAGATGCTGGTGGTTTTTT
TTAG